(data stored in ACNUC7421 zone)

EMBL: CP001069.PE365

CP001069.PE365       Location/Qualifiers
FT   CDS_pept        complement(410495..411253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4140"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rso:RS05313 probable integral membrane transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29241"
FT                   /db_xref="GOA:B2UI40"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI40"
FT                   /protein_id="ACD29241.1"
FT                   /translation="MESATLLLFGAGLLAGMMNALAGGGSFVTLPALMFAGVPSVFANA
FT                   SSTVALLPGAATSAWAYRADYRGFGHVSMRAMVGISLVGGLFGALLLMNTSSRAFDFIV
FT                   PWLLLVGSLAFTFGKQVGVWLRQRVQIGRTTLLVAQGALAIYGGYFGGAVGIMMMAVWA
FT                   LFGHDDIKALNASRTLLVGATNLVAVACFALANMVWWPQTLVMLVAAALGGHLGAHVGK
FT                   RLPVPVVRALISTFGFSMTALLFWRAWSHA"
     atggaatctg ccacgctgct gctttttggc gcgggcctgc tcgccggcat gatgaatgcc        60
     ctggcgggcg gcggctcgtt tgtcaccctg cccgcgctca tgttcgcagg ggttccgtcg       120
     gtgtttgcca atgcgtcgag cacggtcgcg ctgctacccg gcgcggccac gtcggcgtgg       180
     gcgtatcgcg cggactatcg cgggttcggg cacgtctcga tgcgcgccat ggtggggatc       240
     agccttgtgg gggggctgtt cggcgcgctg ctgttgatga acacgtcgtc tcgcgcgttc       300
     gatttcatcg tgccgtggct gctgctggtc ggctctctgg cgttcacctt cggcaaacag       360
     gtcggtgtat ggctgcgcca gcgtgtgcag atcgggcgga caacgctgct ggtggcgcaa       420
     ggtgcgctgg ccatctatgg cggctatttt ggcggcgcag tggggatcat gatgatggcg       480
     gtctgggcac tgttcggcca cgacgacatc aaagcactga acgcctcacg caccttgctg       540
     gtgggcgcga ccaaccttgt ggcggtggcc tgttttgcgc tggcaaacat ggtgtggtgg       600
     ccgcagacgc tggtcatgct ggtggccgcc gcactgggcg gtcatctcgg cgcgcatgtt       660
     ggcaagcgtt tgccggtgcc ggttgtgcgg gcgttgattt ccactttcgg cttttcgatg       720
     acggcgctgc tgttctggcg cgcctggtcg cacgcttga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page