(data stored in ACNUC7421 zone)

EMBL: CP001069.PE366

CP001069.PE366       Location/Qualifiers
FT   CDS_pept        411384..412268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS05312 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29242"
FT                   /db_xref="GOA:B2UI41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI41"
FT                   /protein_id="ACD29242.1"
FT                   /translation="MRFDLTDLRLFLHTAEAGSITAGAERAHLTLASASARIRGMEDAL
FT                   GAPLLTRNRRGVETTAAGRTLVHHARVVLQQMDRMRGELGEYARGLKGYVRLLSNTAAM
FT                   TEFLPETLSAFLAAHPEVDVDLEELVSHEIVEAIAQGRADIGIVNDAVDLSGLETFPFR
FT                   HDRLVLVTAREHPLAERRELAFVETLQEDFVGLTGDNALQAYLAGHAARAGHRLKYRVR
FT                   LRSFDAVCRMVERNVGVGVIPEHAAIRLQRSMGIRRVRLTDAWATRLLRICVRHFDDLP
FT                   VFARQLIEHLREA"
     gtgcgcttcg atctgaccga cctccgactc ttcctccata ccgccgaagc cggcagcatc        60
     acggcggggg cagaacgcgc gcacctgaca ttggcatcgg ccagcgcgcg catccgcggc       120
     atggaagacg cactgggcgc gccgttgctg acccgcaatc gtcgcggtgt ggaaacgacc       180
     gctgccggcc gcacgctggt tcaccacgct cgcgtcgtcc tgcagcagat ggaccgcatg       240
     cgcggtgagc tgggcgaata cgcgcgtggc ttgaagggct acgtgcggct gctctccaac       300
     accgccgcca tgaccgagtt cctgccggaa acgctcagcg ctttcctggc cgctcatcct       360
     gaggtcgacg tcgacctgga agagctggtg agccacgaaa ttgtggaagc gattgcgcag       420
     gggcgcgccg acatcggtat cgtcaacgat gcggtcgact tgtcggggct ggagaccttt       480
     ccgttccgcc acgaccgcct cgtgctggtg accgcgcgcg aacacccgct ggccgagcgc       540
     cgtgagctgg ccttcgttga aaccttgcag gaagattttg tcggcctgac gggcgacaac       600
     gcattgcagg cgtatctggc ggggcatgct gcacgcgccg gccatcggct caaataccgc       660
     gtgcggttac gcagtttcga cgccgtctgc cgcatggtgg aacgcaacgt gggcgtgggc       720
     gtcattcccg agcatgcggc gatccgcctg cagcgctcca tgggcatccg ccgggtgcgc       780
     ctgaccgacg cctgggcgac gcgcctgctg cggatctgcg tgcgccattt cgatgacctg       840
     cccgtcttcg cacgccagtt gatcgagcat ttgcgcgagg cctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page