(data stored in ACNUC7421 zone)

EMBL: CP001069.PE367

CP001069.PE367       Location/Qualifiers
FT   CDS_pept        412413..412934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4142"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05311 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29243"
FT                   /db_xref="GOA:B2UI42"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI42"
FT                   /protein_id="ACD29243.1"
FT                   /translation="MASAGVPPDVPPIGLLHAARALRIYRRHEINALAWIALGVCLRSP
FT                   APMVAISVALLIVCAWSLTRHIQYMKPLYELPVFSRLLTHSGMAFAAVNAALLAVELAT
FT                   GAGRGAWFDADGWLAPAWPQILPDMAGTIELMLVSAQWIVVLGVVVAATAWAWLSLGGG
FT                   RSLRFPPRSQ"
     atggcgtctg ccggtgttcc ccctgatgtt ccgccgatcg gcctgctgca cgcggcgcgt        60
     gcgctgcgca tctatcggcg ccacgagatc aatgcgctgg cgtggatcgc gctgggcgtg       120
     tgcctgcgca gcccggcgcc catggtggcc atcagcgttg cgttgctcat cgtgtgcgcg       180
     tggtcgctca cgcggcacat ccaatatatg aagcccctgt atgaactgcc ggtgttcagc       240
     cgcctgctga cacacagcgg catggcattc gcggccgtca atgcggcgct gctggcggtg       300
     gaactcgcca caggtgccgg acgcggcgca tggttcgacg ccgacggctg gcttgcgccc       360
     gcctggccgc agattctgcc ggacatggcc ggcacgatcg agctgatgct cgtcagcgct       420
     caatggatcg tcgtgctggg cgtggtcgtg gctgcaacgg cctgggcgtg gctaagcctg       480
     ggcggtggtc gctcgctgcg ttttccgccg cgctcgcaat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page