(data stored in SCRATCH zone)

EMBL: CP001069.PE37

CP001069.PE37        Location/Qualifiers
FT   CDS_pept        42354..43079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3797"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS01989 probable amino-acid ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3797"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28913"
FT                   /db_xref="GOA:B2UH62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH62"
FT                   /protein_id="ACD28913.1"
FT                   /translation="MTTLLEVKGLQVSYGHIAAVKGIDFALKAGEITSLVGANGAGKST
FT                   TLLALSGLIPKSQGDVRGQILFEGDDVSQWSAHKRVERGIVQVAEGRATLTTMTVRENL
FT                   ELGAYTRKDRSQIASDLERVFHLFPRLKERIDGMAGNLSGGEQQMLAIGRALMARPRVL
FT                   LLDEPSMGLAPIIVQEIFRILRTINAEGLTIFLVEQNVRQALKIAQHGYVLETGQIVLA
FT                   DSGRNLLGNPRVLEAYLGG"
     atgaccacgc tgctggaagt caaagggctg caggtgtcgt acggacacat cgcagccgtc        60
     aagggtatcg actttgcgct caaggccggc gagatcacct cgctggtggg cgcgaacggc       120
     gcgggcaagt cgaccacgct gctggcgctc tcggggctga tcccgaagtc gcagggcgac       180
     gtgcgtggcc agatcctgtt cgagggggac gacgtttcgc agtggtcggc ccacaagcgt       240
     gtggagcgcg gcatcgtgca ggtcgcggag ggccgtgcca cgttgaccac catgacggtg       300
     cgcgaaaacc tcgagcttgg cgcttatacg cgcaaggacc gcagccagat cgcttccgac       360
     ctggagcgtg tcttccatct gttcccgcgc ctgaaagagc gcattgatgg catggccggc       420
     aacctgtcgg gcggcgaaca gcagatgctc gccatcggcc gcgcgttgat ggcccgcccc       480
     cgtgtgctgc tgcttgacga gccgtcgatg ggcctcgcac cgatcattgt gcaggagatt       540
     ttccgcatcc tgcgcaccat caacgcggaa ggactgacga tcttcctggt tgagcagaac       600
     gtgcggcagg cgttgaagat cgcgcagcac ggctatgtgt tggagaccgg tcagatcgtg       660
     ctggccgaca gcgggcgcaa cctgctgggc aatccgcgcg tgctcgaggc ctacctcggc       720
     ggctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page