(data stored in ACNUC7421 zone)

EMBL: CP001069.PE370

CP001069.PE370       Location/Qualifiers
FT   CDS_pept        complement(415470..415670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29246"
FT                   /db_xref="GOA:B2UI45"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI45"
FT                   /protein_id="ACD29246.1"
FT                   /translation="MGTIKRETAGLTARLGWERHPANWQMIPTRRRLFQTRLPATRAST
FT                   ILLWLLAISITVGVGLLHRLW"
     atgggaacaa tcaaacggga aacagcgggc ttgactgccc ggctggggtg ggaacgtcac        60
     cctgccaatt ggcagatgat tcctacgcgt cggcgccttt ttcaaacacg tcttccggcg       120
     acgcgcgcct ccaccattct gctctggctg ctggccatct cgattaccgt aggtgtcgga       180
     ctgctgcatc gattgtggta g                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page