(data stored in SCRATCH zone)

EMBL: CP001069.PE378

CP001069.PE378       Location/Qualifiers
FT   CDS_pept        complement(423030..423926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29254"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI53"
FT                   /protein_id="ACD29254.1"
FT                   /translation="MPSPLVAIRERIANQVRGLTRATGSLTLDIASPPGDPGLFGPDAV
FT                   CWKVHADFPAMMAGGISALLLQALHPRALAGVWDHSNFREDLQGRLGRTAQFVAGTTYG
FT                   SRHDALALIDRVKTIHDRVQGIAPDGRPYSANDPDLLTWVHVAEMSSFLAGYLRYADAS
FT                   LSGAQQDRYFEETALVAEMLGAQDVPKSRAAVQTYLHAMRAELVASDRTRTVVEVLMTW
FT                   QAPRPGLRPAVRLFLDAGIQLLPPWAIQMLDLKRPPLQAAFASAAMRTVAPTLRWALYE
FT                   GSVARRARRRALTPATS"
     atgccctcgc cactcgtcgc cattcgcgaa cgcatcgcca accaggtccg cggcctgacg        60
     cgcgccaccg gcagcctcac cctcgacatt gcctcgccgc cgggcgaccc gggcctgttc       120
     ggccccgacg cggtctgctg gaaggtccat gccgattttc cggcgatgat ggccggcggg       180
     atcagcgcgc tgttgttgca agcgctgcac ccgcgcgcgc tagccggcgt gtgggaccac       240
     tcgaactttc gcgaagacct gcaaggacgc ctgggccgga ccgcacagtt tgtggccggc       300
     accacgtatg gcagccgaca cgatgcgctg gcgctcatcg accgcgtaaa gaccatccac       360
     gaccgcgtgc aaggcatcgc gcccgatggc cggccgtact cggccaacga ccccgacctg       420
     ctcacctggg tacacgtggc cgagatgtcg agcttcctgg cgggctatct gcgctacgcg       480
     gatgccagcc tgagcggcgc gcagcaggat cgttactttg aagagaccgc gctggtggcc       540
     gaaatgctcg gcgcgcagga cgtgccgaaa tcgcgggcgg cggtccagac ctatctgcat       600
     gcgatgcgcg ccgagctggt ggccagcgat cgtacgcgca cggtggtgga agtcttgatg       660
     acgtggcagg cgccgcgccc ggggttgcgc ccggcggtcc gcctcttcct ggatgcgggc       720
     atccagttgc tgccgccgtg ggcaatacaa atgcttgatc tcaagcggcc gccgctgcag       780
     gcggcgtttg cgtcggcggc catgcgcacc gtggcgccga cgctgcgttg ggcactctac       840
     gagggcagcg tggcgcgccg cgctcgacgg cgggcgctga cgcctgccac aagctag          897
//

If you have problems or comments...

PBIL Back to PBIL home page