(data stored in ACNUC7421 zone)

EMBL: CP001069.PE380

CP001069.PE380       Location/Qualifiers
FT   CDS_pept        complement(425045..425476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29256"
FT                   /db_xref="InterPro:IPR025688"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI55"
FT                   /protein_id="ACD29256.1"
FT                   /translation="MPTLQHVDLRTDPAARPFVKDETVHVDFAAQAGELMSLEGPNRYA
FT                   PGDALITGSTGDRWVVSRERFDAKYVPADASFAHGQAGAYRNRPSVVLAKQMREAFSLA
FT                   RSEAGDVLHGHPGDWVLQYAPGDYGVVQAQRFAKVYRPA"
     atgcctaccc tgcaacacgt cgacctgcgc acggaccccg ccgcccgccc ttttgtgaaa        60
     gacgagaccg tccacgtcga ctttgccgcc caagccggcg agctgatgag cctggaaggc       120
     ccgaaccgct acgcccctgg agatgcactg atcaccggct caaccggcga ccgctgggtc       180
     gtttcgcgcg agcgtttcga tgcgaagtac gttcccgccg atgcatcgtt cgcgcatggt       240
     caggctggcg cttaccgcaa ccgccccagc gtggtgctgg ccaagcagat gcgtgaagcg       300
     ttctcgttgg cgcggtccga agccggtgac gtactgcatg gccaccccgg cgactgggtg       360
     ctccagtacg cccccggcga ctacggcgtc gtgcaggcgc agcgcttcgc caaggtctac       420
     cgcccggcct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page