(data stored in ACNUC7421 zone)

EMBL: CP001069.PE381

CP001069.PE381       Location/Qualifiers
FT   CDS_pept        complement(425737..426768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4158"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit II;
FT                   KEGG: rso:RS03187 putative transmembrane cytochrome BD-II
FT                   oxidase (subunit II) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29257"
FT                   /db_xref="GOA:B2UI56"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI56"
FT                   /protein_id="ACD29257.1"
FT                   /translation="MSTIPDLTQPAGWLPVVFMALMGIAVLAYVVLDGYDLGVGILLRR
FT                   ADDAEKDTMIASIGPFWDANETWLVLGVGLLLVAFPAAHGEILGALYLPVALMLFGLIL
FT                   RGVAFDFRVKARAHHKPWWNRAFYAGSVIATAAQGLMLGLYITGFQYDAANVIFAICTA
FT                   GGLIAGYLLLGATWLIMKTEGALQLRAVLWARGSLWFTALGVAAVSLATPWVSTRVFDK
FT                   WFALPNIILLAPVPLVTIVLFLLIDWVLRRLPQQIAKGDEHLVWAPFVGTGAIFLLAFN
FT                   GLAYSLFPYLVVDRLDIWQAASAPESLEFMLVGVAIVLPTIVGYTIYSYKVFHGKATEL
FT                   RYY"
     atgagcacca ttcctgacct cacccaaccc gccggctggc tgccggtggt cttcatggcc        60
     ctgatgggga tcgccgtgct ggcctacgtc gtcctggacg gctacgacct gggcgtcggc       120
     atcctgctgc gccgcgccga cgacgccgag aaggacacca tgatcgcctc catcggcccg       180
     ttctgggacg ccaacgaaac ctggctcgtg ctcggggtcg ggctgttgct ggtggcgttt       240
     ccggccgcgc atggcgagat cctgggcgcg ctgtatctgc cggtggcgct gatgctgttc       300
     gggctcatcc tgcgtggcgt ggcattcgac tttcgcgtca aggcacgcgc gcaccacaag       360
     ccgtggtgga atcgcgcgtt ctatgccggc tctgtcattg ccaccgcagc gcagggcctg       420
     atgctcgggc tgtacatcac cggcttccag tacgacgcgg ccaacgtcat ctttgcgatc       480
     tgcacggcag gcggcctgat tgccggctac ctgctgctgg gcgccacgtg gctcatcatg       540
     aagacggaag gcgcgctgca gctgcgcgcg gtgctgtggg cacgcggcag cctctggttt       600
     accgcgttgg gcgtggccgc cgtgtcgctg gcgacgccgt gggtcagcac tcgcgtattc       660
     gacaaatggt ttgcgctgcc gaacatcatc ctgctggcgc ccgtgccgct ggtgacaatc       720
     gtgctgttcc tgctgatcga ctgggtactg cgccgcctgc cgcagcagat tgcgaagggc       780
     gatgaacacc tcgtctgggc gccgttcgtc ggcaccggcg ccatctttct gctggccttc       840
     aacggcctgg cctacagcct cttcccgtat ctcgtggtgg accggctcga catctggcaa       900
     gcggccagcg cgccggaatc gctcgagttc atgctggtgg gcgtggccat agtgctgccg       960
     accatcgtcg gctacacgat ctactcgtac aaggtgttcc acggcaaggc gacggagttg      1020
     cggtactact ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page