(data stored in ACNUC7421 zone)

EMBL: CP001069.PE382

CP001069.PE382       Location/Qualifiers
FT   CDS_pept        complement(426765..428138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4159"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: rso:RS03186 putative transmembrane cytochrome BD-II
FT                   oxidase (subunit I) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29258"
FT                   /db_xref="GOA:B2UI57"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI57"
FT                   /protein_id="ACD29258.1"
FT                   /translation="MSLDPVVLARIQFGANITFHILFPTISIALAWVLLFFKLRYRKTG
FT                   DEAWMAAYRLWVKVFALTFALGVVSGVTMSFQFGTNWPGYMNTVGNIAGPLLAYEVLTA
FT                   FFLEASFLGIMLFGTGRVSPRIHTFATFLVALGTTISVFWIIALNSWMQTPAGYVMIDG
FT                   RAHPQSWLAIIFNPSFPYRFTHMLLASGLTVSFLLAGLSAYRWLRNDRGGDVRAAHKTG
FT                   VVLAAMLIPLQIAAGDAHGLNTLEHQPAKLAAIEGIWQTERGVPAVLFGIPDAATRSNR
FT                   HEIAVPKVASLYLTHSLDGEVRGLDQFDQHPPVLPVFFAFRLMVGVGLLMLAVSWTSAW
FT                   RLRRNGELPRWLARTLVAMTFSGWVAVVAGWYVTEIGRQPWLVYGVLTTAQAASSVPAR
FT                   MIGSTLAMYLALYAFLIASYIGVVFYLARKAGGAIDPTDADIPGKHTSELSAPVASHA"
     atgtcactcg atcccgttgt cctggcgcgc atccagtttg gcgccaacat caccttccac        60
     atcctctttc ccaccatcag cattgcgctg gcgtgggtgc ttctgttctt caagctgcgc       120
     tatcgcaaga ccggtgacga ggcctggatg gccgcctatc gcctttgggt gaaggtcttc       180
     gcattgacgt tcgcgctggg cgtggtatcc ggcgtgacga tgagctttca gttcggcacg       240
     aactggcctg gctatatgaa taccgtcggc aatatcgccg ggccgctgct ggcgtatgaa       300
     gtgctgaccg cgttctttct ggaagccagc tttctcggga tcatgctgtt cggcacgggc       360
     cgtgtgagcc cgcgcatcca cacattcgcg acattccttg tcgcgttggg cacgaccatc       420
     tcagtgttct ggatcatcgc gctcaattcg tggatgcaga cacccgccgg ctacgtgatg       480
     atcgacggcc gcgcgcatcc gcaaagctgg ctggcgatca tcttcaaccc gtcgtttccc       540
     taccggttca cgcacatgct gctggcttcg gggctgacgg tgtcgttcct gctggcgggg       600
     ttgtccgctt accgctggct gcgcaacgac cgcggtggcg acgtgcgtgc ggcgcacaag       660
     accggcgtgg tgcttgccgc catgctcatc ccgttgcaga ttgccgccgg agatgcgcac       720
     ggcctgaata cgctggagca tcagcctgcc aagctggccg cgatcgaagg catctggcaa       780
     accgaacgcg gtgtgccggc cgtgctgttc ggcattcccg atgcagcaac gcgcagcaat       840
     cgccacgaga tcgcggtgcc gaaggtggca tcgctgtatc tcacgcactc gctcgacggc       900
     gaagtgcggg ggctcgatca gttcgatcag catccgcccg tgctgcccgt gttcttcgcc       960
     ttccgcctga tggtgggcgt tggcttgctg atgctggcgg tgtcgtggac cagcgcctgg      1020
     cgccttcgcc gcaatggtga actgccgcgc tggctggcgc gcaccctcgt cgccatgacg      1080
     ttctccggct gggtggcggt ggtggccggc tggtacgtga ccgagatcgg ccggcaaccg      1140
     tggcttgtct acggcgtgct gaccaccgcg caggccgcct catccgtgcc cgcgcggatg      1200
     atcggcagca cgctggcgat gtatctcgcg ctgtacgcgt tcctcatcgc ctcctacatt      1260
     ggcgtggtgt tctatctggc ccgcaaggcc ggcggcgcca tcgacccgac cgatgccgac      1320
     atccccggca agcacacctc tgaactttcc gcgcccgtcg cgagccacgc atga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page