(data stored in ACNUC7421 zone)

EMBL: CP001069.PE386

CP001069.PE386       Location/Qualifiers
FT   CDS_pept        430017..431339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03167 probable high affinity nitrate transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29262"
FT                   /db_xref="GOA:B2UI61"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI61"
FT                   /protein_id="ACD29262.1"
FT                   /translation="MTGKATRIDLFSLRTPQMRAFHLTWLAFFVCFYAWFACAPLMPVL
FT                   KGEFHLTPGQIANINIAAVAVTILVRLIVGPLCDRFGPRKTYTGLLLLGAIPVLGVALA
FT                   QSYETFLFFRLAIGAIGASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGGGVAQGTMP
FT                   LLLTAIVMMGVTQSMGWRLAMVVPGVAMLLVAALYWRYTQDCPEGNFSALRAAGKTIEG
FT                   GKKGGWGSFVAAAGNYRVWLLFITYGACFGVEIFIHNIAATYYVDHFGLSLSAAGMAAA
FT                   SFGLLALFARALGGIVSDRVAAKRGLDARTQLLCVLMMGEGLGLFGFAHAGSVPVAILA
FT                   MLGFGLFTHMACGATYALVPFIDRRALGGVAGIIGAGGNAGAVAAGFLLKGMADTQATL
FT                   SILGVLVALSAICAIAVRFSAEHKAREQALYDNTLAAAGNA"
     atgaccggca aagccacccg aatcgacctg ttcagcctgc gtacgccgca gatgcgcgcc        60
     ttccatctga cgtggctcgc gttcttcgtg tgtttctacg cgtggttcgc ctgcgcgccg       120
     ctcatgccgg tgctcaaggg cgagttccac ctcacgccgg ggcagatcgc caacatcaac       180
     atcgcggcgg tggcggtgac gatcctggtg cggctgatcg tcggcccgct gtgcgaccgc       240
     ttcggcccgc gcaagaccta taccggtttg ctgctgctgg gggccatccc cgtgctgggc       300
     gtggcacttg cgcaaagcta cgagaccttc ctgttcttcc gcctggcgat cggcgcgatt       360
     ggcgcgagct tcgtcatcac gcagtaccac acgtcggtca tgttcgcgcc aaacgtggtg       420
     ggcaccgcca acgcggcggc ggccggctgg ggcaacgcag gcggcggtgt ggcgcaaggc       480
     acgatgccgc tgctgctgac cgccatcgtg atgatgggcg tgacgcagag catgggctgg       540
     cgcctggcca tggtggtgcc gggcgtggcg atgctgctcg tcgcggcgct gtactggcgc       600
     tatacgcagg actgcccgga aggcaacttc agcgcactgc gcgccgccgg caagaccatc       660
     gaaggcggca agaagggcgg ctggggcagc tttgtggccg ccgccggcaa ctaccgggtg       720
     tggctgctgt tcattaccta cggcgcgtgc tttggcgtgg agatcttcat ccataacatc       780
     gccgccacct actacgtcga tcacttcggc ctgtcgctct cggctgccgg catggccgcg       840
     gccagcttcg gcctgctggc gctgtttgcc cgcgcgctgg gcggcatcgt gtcggaccgc       900
     gtggccgcca agcgtggcct ggatgcgcgc acccaactgc tgtgcgtgct gatgatgggc       960
     gagggcctgg gcctgttcgg ctttgcccat gcaggcagcg tgccggtggc cattcttgcg      1020
     atgctgggct tcggcctgtt cacgcatatg gcatgcggtg ccacgtatgc gctggtgccg      1080
     ttcattgacc gccgtgcgct cggcggtgtg gccggcatca tcggtgcggg cggcaacgcc      1140
     ggcgcggtgg cggcgggctt cctgctcaag ggcatggccg atacgcaggc cacgctgtcc      1200
     atcctcggcg tgctggtggc gctgtcagct atctgcgcca ttgccgtgcg tttctcggca      1260
     gaacacaagg cacgcgaaca agcgctgtac gacaacacgc tggccgccgc cggcaacgcc      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page