(data stored in ACNUC7421 zone)

EMBL: CP001069.PE387

CP001069.PE387       Location/Qualifiers
FT   CDS_pept        431354..433909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4164"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: rso:RSp1222 probable
FT                   nitrite reductase NADPH (large subunit) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4164"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29263"
FT                   /db_xref="GOA:B2UI62"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI62"
FT                   /protein_id="ACD29263.1"
FT                   /translation="MTMKIVVIGHGMVGHKFLESLLHAPGHHLQVTVLCEEPRPAYDRV
FT                   HLSEFFTGKTAEELSLVAPGFFDRDDVVLKLNARATAIDITAKTVTASTGEVLPYDKLV
FT                   LASGSSPFVPPVPGRDRKDCFVYRTIEDLEAMAECGQRAKTGVVIGGGLLGLECAKALR
FT                   DMNLQTHVVEFAGRLMAMQVDDGGGRMLRRKIEDLGVTVHTQKNTSEIVDGETATHRLN
FT                   FADGTHLEADMVVFSAGIRPRDELARACGLEVGERGGIVIDSECRTSAPDVYAIGECAL
FT                   WGGKIYGLVAPGYEMARITAKQILAADDASEFSGADMSTKLKLMGVDVASLGDAQGVTP
FT                   GSRSVQFTDERKQIYKKLVVSEDGKYLLGGVLVGDAAEYGTLLQMMLNRIELPEAPEFL
FT                   ILPQADGNARPALGVDALPDSAQICSCNDVSKGALCQAVCAGATTVGALKDATKAGTSC
FT                   GGCVPLMTQVMKAEMKKQGLAVNNHICEHFPYSRQELYHLVRVGRIQSFEALLEAHGSG
FT                   MGCDICKPAVASILASCWNDFVLKKEHASLQDSNDYFLANIQKDGTYSVVPRMPGGEVT
FT                   ADGLIAVGQVAKKYDLYTKITGGQRVDLFGARLEQLPLIWEELIAAGFESGHAYGKSLR
FT                   TVKSCVGSTWCRYGVGDSVGFAIALENRYKGLRSPHKIKFGVSGCTRECAEAQGKDVGI
FT                   IATEKGWNLYVCGNGGMKPRHAELLAADLDQETLIKYVDRFLMFYVRTADRLQRTSTWR
FT                   DNLEGGLDYLKDVVINDKLGIVAELEAEMQHVVDTYQDEWKTAVTNPDVRKRFRHFVNS
FT                   EAKDANVVFVEERGQIRPATVEERAKTRPVRIPVVAEAA"
     atgaccatga agatcgtcgt cattggccac ggaatggtgg gccacaagtt tctggaaagc        60
     ctgctgcatg ctccgggcca tcacctccag gtgacggtgc tgtgcgaaga gccgcgcccc       120
     gcctacgacc gcgtgcacct gtcggaattc ttcacgggca agacggcgga agagctctcg       180
     ctcgtggcgc cgggcttctt tgaccgcgac gacgtggtgc tcaagctcaa cgcccgcgcc       240
     acggccatcg acatcaccgc caaaacggtg acggcctcga ccggcgaggt gctgccgtac       300
     gacaagcttg tcctcgcttc gggctcgtcg ccgttcgtgc cgcccgtacc gggccgcgac       360
     cgcaaggact gcttcgtcta tcgcaccatc gaagacctcg aagcgatggc cgaatgcggc       420
     cagcgcgcca agaccggcgt cgtgatcggc ggcgggctgc tggggctgga atgcgccaag       480
     gcgctgcgcg acatgaacct gcaaacgcat gtggtcgagt ttgccggtcg cctgatggcg       540
     atgcaggtgg atgacggcgg cggccgcatg ctgcgccgga agatcgaaga cctcggcgtg       600
     accgtccaca cgcagaagaa cacgtcggag atcgttgatg gcgaaaccgc gacgcaccgc       660
     ctgaactttg ccgacggcac gcacctggaa gcggacatgg tcgtcttctc ggccggcatc       720
     cgcccgcgcg acgaactggc gcgcgcttgc gggctggaag tgggcgagcg cggcggcatc       780
     gtgatcgact ccgaatgccg tacctcggcg ccggacgtct acgcgattgg cgaatgcgcg       840
     ctgtggggcg gcaaaatcta cggcctggtt gcgcccggct acgagatggc gcgcatcacc       900
     gccaagcaga tcctggccgc cgacgatgcg tcggagttca gcggcgccga catgagcacc       960
     aagctcaagc tgatgggcgt ggatgtcgcc agcctgggcg atgcgcaggg cgtgacgccg      1020
     ggcagccgca gcgtgcagtt caccgacgag cgcaagcaga tctacaagaa gctggtggtg      1080
     tcggaagacg gcaagtacct gctgggcggc gtgctggtgg gcgatgcggc ggaatacggc      1140
     acgctgctgc agatgatgct caaccgcatc gagctgcccg aggcgccgga attcctgatc      1200
     ctgccgcagg ccgatggcaa tgcgcgcccc gcattgggcg tggatgcgct gcccgatagc      1260
     gcgcagatct gttcgtgcaa cgacgtatcg aaaggcgcgc tgtgccaggc ggtgtgcgcc      1320
     ggcgccacca ccgtgggcgc gctcaaggat gccaccaagg ccggcacctc gtgtggcgga      1380
     tgtgtgccgc tcatgacgca ggtgatgaaa gccgagatga agaagcaagg cctggccgtc      1440
     aacaaccaca tctgcgagca ctttccgtat tcgcgtcagg agctgtatca cctggtgcgc      1500
     gtgggccgca tccagtcgtt cgaggcgctg ctggaagcgc atggcagcgg catgggctgc      1560
     gacatttgca agcccgccgt cgcgagcatc cttgcttcgt gctggaacga cttcgtcctc      1620
     aagaaagagc acgccagcct gcaggattcc aacgactact ttctcgccaa catccagaag      1680
     gacgggacgt actccgtggt gccgcgcatg cccggcggcg aggtgacggc agacggcctg      1740
     atcgccgtgg gccaggtcgc caagaaatac gacctgtaca ccaagatcac gggcggccag      1800
     cgtgtcgatc tgttcggggc gcggctggag cagttgccgc tgatctggga agagctgatc      1860
     gcggccggct tcgagtcggg tcacgcgtac ggcaaatcgc tgcgcacggt gaagtcgtgc      1920
     gtgggctcga cgtggtgccg ctatggcgtg ggcgattcag tgggttttgc gattgcgctg      1980
     gagaaccgct acaagggcct gcgctcgccg cacaagatca agtttggcgt ctccggctgc      2040
     acgcgggaat gcgccgaagc gcagggcaag gacgtcggca tcatcgccac cgagaaaggc      2100
     tggaacctgt atgtgtgcgg caacggcggc atgaaacccc gccatgccga actgctggcg      2160
     gccgacctcg atcaggaaac gctcatcaag tatgtcgacc gcttcctgat gttctacgtg      2220
     cgcacggccg accgcctgca acgcaccagc acatggcgcg acaacctcga aggcggtctc      2280
     gactatctga aggatgtggt gatcaacgac aagctgggca tcgtggccga actcgaagcc      2340
     gagatgcagc acgtggtcga tacctaccag gacgaatgga agacggccgt gacgaaccct      2400
     gacgtgcgca agcgcttccg ccacttcgtc aacagcgaag ccaaggatgc gaatgtcgtc      2460
     ttcgtcgagg agcgtggcca gatccgccct gccacggtcg aggagcgtgc caagacgcgg      2520
     cccgtgcgca ttcctgttgt tgctgaggcc gcttga                                2556
//

If you have problems or comments...

PBIL Back to PBIL home page