(data stored in ACNUC7421 zone)

EMBL: CP001069.PE39

CP001069.PE39        Location/Qualifiers
FT   CDS_pept        44225..45223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3799"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bam:Bamb_4057 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28915"
FT                   /db_xref="GOA:B2UH64"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH64"
FT                   /protein_id="ACD28915.1"
FT                   /translation="MHARLIQLGEPGPALGLQPADQMLPPPGANVLTVRHTAVGVNFVD
FT                   VYHRTGLYPVPAFPAVLGVEGVGVVEAVGTDVRGFVVGQRVAWAGLMDGAPGGYASHRN
FT                   IPANRAIALPDALDDETVAATLLRGITAHMLLTRVRQVGVGDTVLVHAAAGGLGVLLVQ
FT                   WAKRLGARVIGTVGSEAKAATALGHGADHVVLHRQQDVREAVLQLTAGEGVDYVIDGVG
FT                   GPMLQTSLAVTRPFGMVASIGQAGDVSNVQTSAVDLAALGPSRSIALARPGVFRYMTDL
FT                   SRYRVGAQAALQRMLEGVRVPVGGIYALADAAAAHAALEGGRTSGALLLRP"
     atgcatgcca ggttgatcca actcggtgaa cccggtccag cactggggtt acagccagcg        60
     gaccagatgc ttccgccgcc cggcgcgaat gtgctgacgg tgcggcacac cgccgtgggc       120
     gtgaactttg tcgacgtgta tcaccgcacc ggcctctatc ccgtgccggc atttccggcg       180
     gtgctcggtg tcgagggcgt cggcgtggtg gaagccgtgg gcaccgacgt acgtggcttt       240
     gtcgtaggcc agcgcgtggc gtgggccgga ctaatggatg gtgctcccgg cggctacgcc       300
     agccatcgca acattcccgc caaccgcgca attgccttgc ccgatgcgct ggacgacgaa       360
     accgttgccg ccacgctgct gcgtggcatc accgcacaca tgttgctgac gcgcgttcgg       420
     caggttggcg tgggtgacac ggtgctggtg cacgcagcag caggaggcct gggcgtgctc       480
     ctcgtgcaat gggcaaagcg cctgggcgca cgcgtgatcg gcacggtcgg tagcgaagcc       540
     aaggcagcga cagcgcttgg ccacggagca gaccacgtcg tgctgcaccg ccagcaggat       600
     gtgcgcgagg ctgtgctgca actgacggca ggtgagggcg tcgactatgt catcgacggg       660
     gtcggcgggc cgatgctgca gacgtccctg gctgtgacgc ggccgttcgg catggtcgca       720
     agcatcggtc aggctggcga cgtgagcaac gtgcagacga gcgccgtcga tcttgccgcg       780
     cttgggccgt cgcgttcgat tgcactggca cggccgggcg tgttccgcta catgacggat       840
     ctgtcgcgct accgggtggg tgcgcaggca gcgctgcagc gcatgctgga gggcgtgcgt       900
     gtgccggtgg gcggcatcta cgcgctggct gacgcggccg ccgcgcacgc ggcgctcgag       960
     ggcgggcgca cgtcgggcgc gttgctgctg cgtccttga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page