(data stored in SCRATCH zone)

EMBL: CP001069.PE391

CP001069.PE391       Location/Qualifiers
FT   CDS_pept        438704..439318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29267"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI66"
FT                   /protein_id="ACD29267.1"
FT                   /translation="MVAAAIHACTAFAGTRRLAAGPVRDVARVVKIHVDAHPESQVLVF
FT                   DHTTAQPVEFDLRGTVGDVLARLDSTAPSATQPAESESRPRGPGRPKLGVIAREVTLLP
FT                   RHWDWLAAQPGGASVTLRKLVEDARRAAEGADRRRVAQEAAYRFMSAMAGDAAGFEEAT
FT                   RALFAADAVAFESLTHSWPADVRDFARELASRAFNPQQEAA"
     atggttgccg cagcaatcca cgcgtgcacg gcatttgccg gcacccggcg cttggccgct        60
     gggcccgtcc gcgacgtcgc ccgggtcgtc aagatccacg tcgatgcaca ccctgaatcg       120
     caggtgctgg tgttcgacca caccaccgca cagccggtgg aattcgactt gcgcggcacg       180
     gtaggagacg tgcttgcccg tctcgattca accgcgccgt ctgccacgca acccgctgag       240
     tcggaaagtc gcccgcgtgg ccctggccgc cccaagctgg gcgtgattgc ccgcgaggtc       300
     accttgctgc cgcgccactg ggattggctg gccgcgcagc cgggcggggc gtcggtcacg       360
     ctgcgcaagc tcgtggaaga cgcgcgccgc gctgccgaag gcgccgaccg ccgccgcgtt       420
     gcgcaggagg cggcgtaccg tttcatgtcg gccatggcgg gcgatgccgc gggctttgaa       480
     gaggccacgc gcgccctgtt tgccgcagat gccgtcgcgt tcgaatccct cacacattcc       540
     tggcctgccg acgtgcgcga ctttgcgcgc gagctggcga gccgggcctt caatccccaa       600
     caggaggctg catga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page