(data stored in SCRATCH zone)

EMBL: CP001069.PE392

CP001069.PE392       Location/Qualifiers
FT   CDS_pept        439315..440682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4169"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: rso:RS03157
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29268"
FT                   /db_xref="GOA:B2UI67"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI67"
FT                   /protein_id="ACD29268.1"
FT                   /translation="MTAPAARPLWRTFIAFLGPLILANILQSLSGTLNNVYVGHMLGVK
FT                   ALAAVSAFFPILFFFIAFIIGLGSGAAVLIGQAWGAKKPEAVKTVAGTTLSVGFIVGLA
FT                   VALLGGPFANALLGWLGTPADILQDATLYASVMLYAMPGLFVYLLATAMMRGVGDTRTP
FT                   LRTLALSTSIGLVLTPTFIRGWFGLPQLGVASGAAATIISFTIALVWLAFFLRRRNHPL
FT                   APDAVLARHLWVDFGVLKTVLKIGVPTGLQLVVISIAELALLSFVNGFGSDATAAYGAG
FT                   TQIISYVQFPAMSIAITASILGAQAIGSGNTERLDAITRTGLWLNVAITGVLVLMALLF
FT                   SRAVIGWFTTSAEVMSLAQSLLHISLWSSVIFGMASVFSGVMRSSGTVMAPTAISILAI
FT                   AAVEVPVAWVLSRHIGTDGIWAAYPAAFLAMFVMQGLYYALVWRRRAQRFGIRRMV"
     atgacagcgc ctgctgctcg cccgttgtgg cgaacattca ttgcattcct cggcccgctg        60
     atcctggcca acatcctgca atcgttgtcg ggcacgctca acaacgtcta tgtgggccac       120
     atgctgggcg tgaaggcgct ggctgcggtg tcagcgttct tcccgatcct gttcttcttc       180
     atcgccttca tcatcgggct ggggtcggga gcggcggtgt tgatcgggca ggcgtggggc       240
     gccaagaagc ccgaggcggt caagaccgtt gcgggcacca cgctctccgt gggtttcatc       300
     gtgggcctgg cggtggcgct gctgggaggc ccgttcgcaa acgcgctgct gggttggctc       360
     ggcacgccgg ccgatatcct gcaggacgcc acgctctacg ccagcgtcat gctctatgcc       420
     atgccgggcc tgttcgtcta cctgcttgcc acggcgatga tgcgcggcgt gggcgatacg       480
     cgcacgccgc tgcgcaccct cgcgctgtcg acgtcgatcg ggctggtgct gacgccgacc       540
     ttcattcgcg gctggttcgg cctgccgcaa ctgggcgtgg caagcggcgc cgcggcgacc       600
     atcatttcgt tcacgatcgc gctggtgtgg ctcgcattct tcctgcgccg ccgcaaccat       660
     ccgctcgcgc ccgatgccgt gctggcccgg cacttgtggg tcgattttgg tgtgctcaag       720
     accgtgctga agatcggtgt gccgacgggc ttgcagcttg tggtcatctc gattgccgag       780
     ctggcgctgc tgtcattcgt caacggcttc ggctccgacg cgacggccgc ctacggcgcc       840
     ggcacgcaga tcatcagcta cgtgcagttt cccgccatgt cgattgcgat cacggcgtcc       900
     atcctcggtg cgcaagccat cggctcgggc aatacggagc ggctcgatgc catcacgcgc       960
     accgggctgt ggctcaacgt tgcgattacc ggtgtgctgg tgctgatggc gttgctgttt      1020
     tcgcgcgcgg tcatcggctg gttcaccacc agcgcagaag tgatgagcct tgcccagagc      1080
     ctgctgcata tctcgctgtg gagttcggtc atctttggca tggcgagcgt cttctcgggc      1140
     gtgatgcgct caagcggcac ggtgatggcg cccacggcca tttccatcct cgccatcgcg      1200
     gcggtggaag tgccggtggc ctgggtgctg agccggcata tcggcaccga cggcatctgg      1260
     gctgcatatc cggccgcctt ccttgccatg ttcgtgatgc aggggctgta ctacgcgctc      1320
     gtgtggcgcc gccgcgcgca gcggttcggt atccgccgca tggtttga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page