(data stored in ACNUC7421 zone)

EMBL: CP001069.PE399

CP001069.PE399       Location/Qualifiers
FT   CDS_pept        complement(449181..450086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4176"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: rso:RS03149
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29275"
FT                   /db_xref="GOA:B2UI74"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI74"
FT                   /protein_id="ACD29275.1"
FT                   /translation="MLELQPLDIPLAIPLPWPMLDADGQLLVPKGDVIHSPEEIDLLCT
FT                   LHRPHRLADGTPAPAPAFANTQFPNTMFPDMGDDPDGERTIAMELLGLRPGGMLTVRLT
FT                   AGAGQTKGAARVMGYSPQRHLLITMPTDSGRTVMPVKDELVEVHAFSGEGIASFECTVM
FT                   AVCRIPFEYVVLSPPRRIKNRALRKSLRVRANVVGKMLVSGDPPRMIHISDISTTGASF
FT                   RSAHRLEVSGAPARLRFRVKTRDYHSELVAAALVRSEKPADLPNVYQYGVEFVELVAAQ
FT                   KMLLQCFIYEQLLWGGQRMV"
     atgctcgaac ttcaacctct cgacattccg cttgcgattc ccctgccgtg gccgatgctt        60
     gacgccgacg ggcagttgct cgtcccgaag ggcgacgtca tccactcgcc ggaggagatc       120
     gacctgctgt gcacgctgca ccgcccgcat cggctggcgg acggcacgcc cgcgcctgca       180
     ccggcgtttg caaacacgca gttcccgaac acgatgttcc cggacatggg cgacgaccct       240
     gacggtgaac gcacgatcgc catggaactg ctgggcctgc gccccggcgg catgctgacc       300
     gtgcgcctga ccgcaggcgc cggccagacc aagggtgccg cgcgcgtgat gggctacagc       360
     ccgcagcgcc atctgctcat caccatgccc accgacagcg gccgcacggt catgccggtc       420
     aaggacgaac tggtggaagt ccacgctttc tcgggcgagg gcatcgccag cttcgaatgc       480
     acggtgatgg cggtgtgccg catcccgttc gaatacgtcg tgttgtcgcc gccgcggcgg       540
     atcaagaacc gcgcgttgcg caaatcgctg cgcgtgcgcg ccaacgtggt cggcaagatg       600
     ctggtgagcg gcgacccgcc acgcatgatc catatctccg acatcagcac cacgggcgcg       660
     tcgttccgct cggcgcatcg gctggaagtg agcggcgcac cggcgcgtct gcgcttccgg       720
     gtgaaaacgc gcgactacca ttccgaactg gtggctgctg cgctggtgcg cagtgaaaaa       780
     ccggccgacc tgcccaacgt gtatcaatat ggcgtggaat tcgtcgagtt ggtcgccgcc       840
     caaaagatgc tgctgcagtg ctttatctat gaacagttgc tttggggtgg gcagcgcatg       900
     gtgtaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page