(data stored in SCRATCH zone)

EMBL: CP001069.PE4

CP001069.PE4         Location/Qualifiers
FT   CDS_pept        complement(2647..3636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3764"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: rso:RS02223 putative
FT                   ribonuclease RNase BN (RBN) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28880"
FT                   /db_xref="GOA:B2UH29"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH29"
FT                   /protein_id="ACD28880.1"
FT                   /translation="MRLAGSFLDRDVFRRTARILLGAAQQWSAHRAASKGAALSFYTLF
FT                   SMAPVLVLVISIAGLFFGEQAARGEIFGQIQGLVGAQGAAAVETILAATKRSGHGLFAA
FT                   VMALALLVVGATTAFSELKDSLDELWDVPPRQQPGLWGLLRSRLLSFSLVLVLAFLLLV
FT                   SLIINAALAVLERFWGAIWESAGLFAPIAEAFSSVFSFAVVSLLFGTIFKMLPETRVAW
FT                   RDVALGAVVTALLFTLGKHLIGLYLGNSAVASSYGAAGSVVALMLWIYYSAQIFFFGAL
FT                   VTRQYALQFGSRQHETAGPGAQAALLNPALAANLASGSGTGPGVREGR"
     atgcgcctgg ccggctcttt ccttgatcgc gatgtgttca ggcgcactgc caggatcctg        60
     ctgggtgccg cgcagcagtg gtctgcgcac cgcgcggcca gcaaaggcgc ggcgctgtcg       120
     ttctatacgt tgttttccat ggcgccggtg ctggtgctcg tcatttccat cgccggcctg       180
     ttttttggcg agcaggcggc gcgcggggag attttcggcc agatccaggg cctggtgggc       240
     gcacagggcg cggccgccgt cgagaccatc ctggccgcga ccaagcggtc gggccatgga       300
     ctgtttgccg cggtgatggc cctggcgctt ctggtcgtgg gcgccaccac ggcattttcc       360
     gaactgaagg acagcctgga cgaactgtgg gatgtgccgc cgcgccagca gcctgggctg       420
     tggggtctgc tgcggtcgcg gctgctgtct ttcagcctgg tgctggtact ggccttcttg       480
     ctcttggtgt cgctcatcat caacgcggcg cttgccgtgc tcgagcggtt ctggggcgcg       540
     atatgggaga gcgcagggct gttcgcgccg atcgcggaag cgttttcgtc ggtattttcc       600
     ttcgcggtcg tatcgctgct cttcggcacc atcttcaaga tgctgcccga aacgcgcgtg       660
     gcctggcgcg acgtggcgct tggcgcggta gtcacggcgc tgctcttcac gctcggcaag       720
     catctcatcg ggctgtacct gggcaacagc gcggtcgcct cgtcgtatgg tgccgcgggc       780
     tcggtcgtgg cgctgatgtt gtggatctac tactcggcgc agatcttttt cttcggtgcg       840
     cttgtcaccc gccagtacgc gctgcagttc ggcagccgcc agcacgagac cgcggggccg       900
     ggtgcgcagg ctgcgctgct caacccggcg cttgcagcca atctggcaag cggcagcggc       960
     accggccccg gggtgcgcga agggcgctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page