(data stored in ACNUC7421 zone)

EMBL: CP001069.PE401

CP001069.PE401       Location/Qualifiers
FT   CDS_pept        complement(450735..451217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29277"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI76"
FT                   /protein_id="ACD29277.1"
FT                   /translation="MELSFVAPGTQTHRYALKLAGLPEGTEPGTTPVDPAWVDDALTAA
FT                   VRVFDAHRVHFADAYFAYRARETAQQPTRTAGKTPTARVAGDLHDDTPLLADTFAIAQL
FT                   AALVSLEASGVADVIDIHLVVERLRDDAPVPPADGIGDVTFATETGAGVQSPASRH"
     atggaattga gctttgtcgc ccccggcacg cagacgcatc ggtatgcgct caagctagcg        60
     ggcctgcccg aaggtaccga gcccggaacg acgccagtcg atccagcttg ggtggacgat       120
     gcccttaccg ccgcagtgcg cgtgttcgac gcgcaccgcg tgcactttgc cgacgcctat       180
     ttcgcctatc gcgcacgtga aacggcgcag cagcccacgc gcacggccgg caagacccca       240
     actgcccgcg ttgccggcga tctccacgac gatacgccgc tgctcgcgga tacgtttgcg       300
     attgcgcaac tggcggcact tgtctcgctg gaggcgtccg gcgtggccga tgtgatcgac       360
     attcacctgg tggtggagcg cctgcgggac gatgcccccg tcccgcccgc tgacggcatt       420
     ggcgacgtga ccttcgctac ggaaactggc gccggcgtgc agagcccggc cagccggcat       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page