(data stored in ACNUC7421 zone)

EMBL: CP001069.PE402

CP001069.PE402       Location/Qualifiers
FT   CDS_pept        451870..453210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4179"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RS03147 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29278"
FT                   /db_xref="GOA:B2UI77"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI77"
FT                   /protein_id="ACD29278.1"
FT                   /translation="MLEDDHLYKAAIEHSPIGIGLCAPEGRFLDVNRALCALTGHEAQA
FT                   LRTRDLFDLCHPDHTERTRHGIESLLTGQRDALSMETRLVRQDGTTVWVQTDVAVAHDH
FT                   GNQHLVVQMQDVTARRLALESLRASEQRLAYVLDGAGLGTFDWSTRARHVSFNRRTADM
FT                   LGYEPTDLSNDPDAWFAMVHPQDAALSARRIYRHMRGDADSFEIEQRMRARHGQWIWVA
FT                   ARGRVTERDARGMATRVSGTLLDVTKRRTALDQAHHLALHDPLTDLPNARLLRDRLFVA
FT                   IQAARRARGQVAVVFIDLDRFKPVNDEYGHAVGDLVLKATAMRLRSGLRASDTVARLGG
FT                   DEFVAVLTHCATRDDVTQTVERLIEQLQTPFRVEGHVLSMGVSAGVALYPTDGRDAQTL
FT                   IRNADAAMYEVKRAGGNGLGFHASLNYERLMGMRSRDRDLDGEADAR"
     atgcttgagg acgaccactt gtacaaggct gcgatcgaac attcgccgat aggaatcggc        60
     ctgtgcgcgc cggagggtcg cttcctcgac gtgaaccgag cgctgtgcgc gctgaccggt       120
     cacgaagcac aggcgctgcg cacgcgcgat ctgttcgacc tgtgccaccc cgatcacact       180
     gaacgcacgc gacacggcat cgagtcgctg ctcaccggcc agcgcgatgc gctgtcgatg       240
     gaaacgcgcc tggtccgtca agacggcacc accgtctggg tgcagaccga cgtggcggtg       300
     gcgcacgatc acggcaacca gcacctcgtc gtgcagatgc aggatgtgac cgcgcggcgc       360
     ctggcgctgg aatcgctgcg cgcgtcggag caacggctgg cctatgtgct ggacggtgcc       420
     gggctgggta cgttcgactg gtccacgcgt gcgcggcatg tgtcgttcaa ccgccggacg       480
     gccgacatgc tcggctacga gccgaccgat ctgtccaacg atccggatgc gtggttcgcc       540
     atggtgcatc cgcaggacgc cgcattgagc gcgcggcgca tctatcgcca tatgcgcggt       600
     gatgccgaca gctttgaaat cgagcagcgc atgcgcgcgc gccatggcca atggatctgg       660
     gtggctgcgc gcgggcgcgt gaccgagcgt gatgcccgcg gcatggccac gcgcgtgagc       720
     ggcacgctgc tcgacgtgac aaagcggcgc acggcgctgg accaggcgca ccaccttgcg       780
     ttgcatgatc cgctgacgga cttgcccaac gcacgtttgc ttcgcgatcg cctgttcgtc       840
     gccattcaag cggcgcgtcg cgcgcgcggt caggtcgccg tcgtgttcat tgatctcgat       900
     cgcttcaagc ccgtcaacga tgagtacggc cacgcggtgg gtgatctcgt cctgaaggcc       960
     acggcgatgc ggttgcgtag cgggctgcgc gcctccgaca cggtggcgcg cctgggcggc      1020
     gatgaatttg tcgccgtcct cacgcattgc gccacgcgcg acgatgtgac gcaaaccgtg      1080
     gagcgcctga tcgagcaatt gcagacgccg ttccgtgtgg aaggccatgt gctgtcgatg      1140
     ggcgtgagtg ccggcgtggc gctgtatccg accgacgggc gtgatgcgca gacgctcatc      1200
     cgcaatgccg acgctgcgat gtatgaagtc aagcgtgccg gtggcaacgg cctgggtttc      1260
     catgcatcgc tcaactacga gcggctgatg ggcatgcgat cgcgcgatcg tgatctcgac      1320
     ggcgaagccg acgcccgcta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page