(data stored in ACNUC7421 zone)

EMBL: CP001069.PE403

CP001069.PE403       Location/Qualifiers
FT   CDS_pept        complement(453289..453852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4180"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS03145 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4180"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29279"
FT                   /db_xref="GOA:B2UI78"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI78"
FT                   /protein_id="ACD29279.1"
FT                   /translation="MIRSALPRSAKLLAAALGAATLFAALPAQADPSVRAIYGKDNKHG
FT                   IEKYGVDLDFDSGFHWGNPEGWFVNLDWEVALGQWRSTKGTNRQNITEFGVTPLFRLEK
FT                   RGGSWVPFIEAGVGPRLLSHVSTSNEHYFSTAFQFSDMIGVGVAFGSKQQFQMGYRFEH
FT                   LSNASIKRPNPGTDLNELYLRYTF"
     atgatccgat ccgcgcttcc ccgttccgcc aagctgctgg ccgccgccct gggcgccgcc        60
     acgctgtttg ctgccctgcc cgctcaggct gacccgtccg tgcgcgccat ctacggcaaa       120
     gacaacaagc acggcatcga gaaatacggc gtcgacctgg atttcgactc gggcttccac       180
     tggggcaacc cggaaggctg gttcgtgaat ctggattggg aagtcgcgct gggccaatgg       240
     cgctcgacca agggcaccaa ccgccaaaac atcaccgaat tcggcgtgac gccgctattc       300
     cgccttgaaa agcgcggcgg ttcgtgggta ccgttcatcg aagctggtgt cggcccgcgc       360
     ttgctgtcgc acgtcagcac gtccaatgaa cactatttca gcacggcctt ccagttctcc       420
     gacatgattg gcgtgggcgt ggcctttggc agcaagcagc aattccagat gggctaccgc       480
     ttcgaacacc tgtcgaacgc gtcgatcaag cgcccgaacc ccggcaccga tctgaacgag       540
     ctgtacttgc ggtacacgtt ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page