(data stored in SCRATCH zone)

EMBL: CP001069.PE405

CP001069.PE405       Location/Qualifiers
FT   CDS_pept        complement(455661..458762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4182"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS03143 probable drug efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29281"
FT                   /db_xref="GOA:B2UI80"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI80"
FT                   /protein_id="ACD29281.1"
FT                   /translation="MNLSATFIARPVATALLTIGVALAGIAAFRLLPVSPLPQVDFPTI
FT                   SVNASLPGASPETMAATVATPLERSLGRIAGITEMTSSSSLGSSRITLQFDLSRDIDGA
FT                   ARDVQAAINASRSLLPSGLPSNPTYRKVNPADAPIMIVGLTSDTKSRGELYDAASTILA
FT                   QKLSQINGVGQVSIGGASLPAVRVELNPMALNKYGISMETVRTVITSTNANKPKGMMES
FT                   GDRVWTIYANDQAKKAVEYQSLIIAWRKGSPVRLADVAEVTDSVQDIRNYGSANGKPSV
FT                   LLIISRQPGANIIDTVDRINDVLPYLRNTIPAQINLDVMMDRTPTIRASLKDVERTLVL
FT                   SIALVIMVVFLFLRNVRATLIPSVAVPVSLIGTFGVMYLCGYSLDNLSLMALTVATGFV
FT                   VDDAIVVLENVSRHIENGMRPMQAALKGAREVGFTVVSMSFSLIAVFIPLLMMGGIVGR
FT                   LFREFAVTLSVAILVSLVVSLTTTPMMCARLLKPAAEEEHGWFHRKTEGFFTFLLDIYR
FT                   NSLAWALRHSWLTLLILLATVCLNVYLYIIVPKGFFPQQDTGRVIGFIQADQSISFQAM
FT                   RTKLTDFITIVRQDPAVENVVGFTGGSQRNTGQMFIQLKPLAERRMSADQIINRLRGKL
FT                   AGEPGASLFLQSVQDIRVGGRASNAQYQYTLQADDLNELRAWDPKIKQALTQVKSLTDV
FT                   NTDTQDKGLQTSLVIDRDKAKSLGINPSDIDNALNNAFGQRQVSTIYNPLNQYRVVMEA
FT                   APQYWQNPDGLRDIYIITSTGAQVPLSTFSHYEPTNTALAVNHQGQFAASTISFNLAPG
FT                   ASLSGATQDIQDAMNRIGVPSSVHGSFQGTAKAFQDSLSSQPVLILFALITIYIVLGLL
FT                   YESYVHPITILSTLPSAGVGALLALIITDTDFSIIALIGVILLIGIVKKNAIMMIDFAL
FT                   EAERSQGMSPADAIFHACVLRFRPILMTTMAALLGALPLALGHGDGAELRTPLGISIVG
FT                   GLLVSQILTLYTTPVVYLALDRLRLRRAGRSKDAPLPALDSQGS"
     atgaacctgt ccgccacctt catcgcgcgg ccggtcgcca cggcgctgct gaccattggc        60
     gtggcgttgg ccggtatcgc ggcgttccgc ctgctgccgg tgtccccgct gccgcaggtc       120
     gattttccga ctatctcggt caacgcttcg ctgccgggcg ccagccccga gaccatggcg       180
     gctaccgtcg cgacgccgct ggagcgctcg ctcggccgca tcgcgggcat taccgagatg       240
     acctcgtcca gctcgctcgg ctcgtcgcgg atcacgctgc agttcgatct gtcgcgcgac       300
     atcgacggcg ccgcgcgcga cgtgcaggct gccatcaatg cttcgcgcag cctgctgcct       360
     tcgggcctgc cgagcaaccc gacgtatcgc aaggtcaatc cggccgatgc gccgatcatg       420
     atcgtggggc tgacgtccga caccaagtcg cgcggcgagt tgtacgatgc ggcctcaacc       480
     atccttgcgc agaagctgtc gcagatcaac ggcgtgggcc aggtctccat cggcggagct       540
     tcgctgccgg cagtgcgggt cgagctgaac ccgatggcgc tgaacaagta cggcatctcg       600
     atggagaccg tgcgcaccgt catcaccagc acgaacgcga acaagcccaa gggcatgatg       660
     gaatcgggcg accgcgtctg gaccatctac gccaacgacc aggcaaagaa ggccgtcgaa       720
     taccagtcgc tcatcatcgc ctggcgcaaa gggtcgccgg tgcggctggc cgacgtggca       780
     gaagtgactg acagcgtgca ggacatccgc aactacggct cggccaacgg caagccctcg       840
     gtgctgctca tcatcagccg gcaaccgggc gccaacatca tcgacacggt cgaccgcatc       900
     aacgacgtgc tgccgtacct gcgcaacacc attcccgcgc agatcaacct cgatgtgatg       960
     atggaccgca cgcccaccat ccgcgcctcg ctcaaggatg tagagcgcac gctggtgctg      1020
     tcgatcgcgc tggtgatcat ggtggtgttc ctgttcctgc gcaacgtgcg ggcgacgctc      1080
     attccgagcg tggcggtgcc ggtctcgctg atcggcacat tcggggtgat gtacctgtgc      1140
     ggctacagcc tcgacaacct ctcgctgatg gcgttgacgg tggcgacagg ctttgtcgtg      1200
     gacgacgcca tcgtggtgct cgagaacgtc tcgcgccaca tcgagaacgg catgcggccc      1260
     atgcaggcgg cgctcaaggg tgcgcgcgag gtcggcttca cggtggtgtc gatgagcttt      1320
     tcgctgatcg ccgtgttcat tccgctactg atgatgggcg gcatcgtggg ccggctgttc      1380
     cgggagtttg cggtgacgct gtcggtggct atcctggtat cgctggtggt atccctcacc      1440
     accacgccga tgatgtgcgc gcgcttgctc aagcccgccg ccgaggaaga acacggctgg      1500
     tttcaccgca agaccgaagg cttcttcacc ttcctgctcg acatctaccg caactcgctg      1560
     gcgtgggcgc tgcggcacag ctggcttacc ctgctcatcc tgttggcgac ggtctgcctg      1620
     aacgtctacc tgtacatcat cgtgcccaag gggttcttcc cgcagcagga caccggccgt      1680
     gtgatcggtt tcatccaggc ggaccagtcg atctcgttcc aggcgatgcg caccaagctg      1740
     accgacttca tcaccatcgt tcggcaagac cctgcggtgg agaacgtggt gggctttacg      1800
     ggcggcagtc agcgcaatac cgggcagatg ttcattcagc tcaagccgct ggccgagcgc      1860
     aggatgtccg ccgaccaaat catcaaccgg ctgcgcggca agctggcggg tgaacccggc      1920
     gcgagcctgt tcctgcaatc ggtgcaggac atccgggtcg gcggtcgggc cagcaacgcg      1980
     cagtaccaat acacactgca ggccgacgac ctgaacgagc tgcgcgcgtg ggacccgaag      2040
     atcaagcagg cgctcacgca ggtgaaatcg ctgacggacg tcaacactga tacgcaggac      2100
     aagggcctgc agacgtcgct cgtcatcgac cgcgacaagg ccaaatcgct cggcatcaac      2160
     ccgagcgata tcgacaacgc cctgaacaac gcgttcgggc agcgccaggt atcgaccatc      2220
     tacaacccgc tcaaccaata ccgcgttgtg atggaagcgg cgccgcagta ctggcagaac      2280
     cccgacggtc tgcgtgacat ttacatcatc acctcgacgg gtgcgcaggt accgctgtcg      2340
     accttctcgc actacgagcc caccaacacg gcgctggcgg tcaaccacca ggggcagttt      2400
     gcggcaagca cgatctcgtt caacctcgcg ccgggggcat cgctgtccgg tgcaacgcag      2460
     gacatccagg acgcgatgaa ccgcatcggc gtgccgtcct ccgtgcatgg aagcttccag      2520
     ggcaccgcga aggcgttcca ggattcgctc tcgagtcagc cggtgctgat cctgtttgcg      2580
     ctcatcacca tctacatcgt gctgggcttg ctgtatgaga gctacgtcca cccgatcacg      2640
     attctctcta cgctgccctc ggccggtgtg ggggcgctgc tggcactgat cattaccgac      2700
     acggactttt cgatcatcgc gctgatcggc gtgattctgc tcatcggcat cgtcaagaag      2760
     aacgccatca tgatgatcga cttcgcgctg gaggcggagc gcagccaggg catgagcccg      2820
     gcggatgcaa tcttccacgc ctgcgtgctg cgcttccggc cgatcttgat gacgacgatg      2880
     gcggcgctgc tgggcgccct gcccctggcg ctgggccacg gcgacggcgc ggagctgcgt      2940
     acgccgctgg gcatctccat tgtcggcggg ctgctggtca gccagatcct tacgctctac      3000
     accacgccgg tggtctacct ggcgctcgac cggctgcgcc tgcgccgcgc cggccgcagc      3060
     aaggacgcac cgctgcccgc attggattcg caaggaagct ga                         3102
//

If you have problems or comments...

PBIL Back to PBIL home page