(data stored in ACNUC7421 zone)

EMBL: CP001069.PE406

CP001069.PE406       Location/Qualifiers
FT   CDS_pept        complement(458759..461893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4183"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS03142 probable drug efflux PUMP transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29282"
FT                   /db_xref="GOA:B2UI81"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI81"
FT                   /protein_id="ACD29282.1"
FT                   /translation="MNPSRIFILRPVATTLLMVAILLSGLVAYRMLPLSALPEVDYPTI
FT                   QVTTLYPGASPDVMTSSITAPLERQFGQMPGLKQMTSSSSGGASVITLQFDLSLSLDIA
FT                   EQEVQAAINAAGNLLPNDLPMPPIYSKVNPADAPILALAITSNTMPLPKLEDLVDTRIA
FT                   QKLSQLPGIGLVSISGGQRPAVRIQANTSALAALGLSIDDIRTAIGTANVNGAKGSFDG
FT                   PMRASTIDANDQLKSAAEYSKMIVAYKNGAPIRLTDVAQIVDGAENSKLAAWSNTTPAI
FT                   ILNVQRQPGANVIEVVNRAKALLPQLKETLPGNVEVSLLTDRTTTIRASVSDVQFELML
FT                   AVALVVMVIFLFLRNVPATVIPAVAVPLSLVGTFGVMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIARYIEEGDPPMEAALKGSKQIGFTIISLTFSLIAVLIPLLFMGDVVGR
FT                   LFREFAITLAVSILISAVVSLTLTPMMCARLLKHIPEAEQSRFYHAAGAFFDNVIARYG
FT                   RMLQWVLDRQKTTLLVAIGTLVLTGLLYVVVPKGFFPVQDTGVIQGISDASQSISFSAM
FT                   AERQQKLAEVVLKDPAVESLSSFIGVDGVNTTLNSGRMLINLKPKDERDADATEIIQRL
FT                   QPELAKVAGISLYMQPVQDLTIEDRVSRTQYQFTVEDPDPNNLSKWVPKLVERLQQTRE
FT                   LRDVASDLQDNGLRAYVQVDRDKAAVYGITMAAVDSVLYSAYGQRLISTIFTQSNQYRV
FT                   VLETDPKMQLGPQSLYDLHVASSSGQQIPLGAFATVVEQPGSLVVNHQGQFPAATISFN
FT                   LAPRASLGAAVDTINAVEEEIGLPASMQTSFQGAALAFRASLSNQLWLILAAIITMYIV
FT                   LGVLYESTIHPVTILSTLPSAGVGALLSLLVSGKDMGIIAIIGIILLIGIVKKNAIMMI
FT                   DFALEAEREQGMAPRDAIYQACLLRFRPILMTTMAALLGALPLMLGTGVGSELRQPLGI
FT                   TMVGGLLVSQVLTLFTTPVIYLAFDSLGGRLRDWRARRAARRHGAAGANQSGGQR"
     atgaatccct cccgaatctt catcctccgg cctgtggcga ccacgctgtt gatggtcgcc        60
     atcctgctct cgggcctggt ggcgtaccgg atgctgccgc tctctgcgct gcccgaagtc       120
     gattacccga ccatccaggt cacgacgctg tacccgggtg ccagccccga tgtgatgacg       180
     tcgtccatca ccgcaccgct cgaacgccag ttcgggcaga tgccgggcct gaagcagatg       240
     acgtcatcca gctcgggcgg cgcctcggtc atcacgctgc agtttgatct gtcgctctcg       300
     ctcgacattg ccgagcagga agtacaggcg gccatcaacg cggccggcaa cctgctgccg       360
     aacgacctgc cgatgccgcc gatctacagc aaggtgaacc cggccgacgc gccaatcctt       420
     gcgctggcga tcacctccaa cacgatgccg ctgcccaagc tggaagacct cgtcgacacg       480
     cgcatcgcgc aaaagctgtc gcagttgccc ggcattggcc tggtcagcat cagcggcggg       540
     cagcggcccg ccgtgcgcat ccaggccaat acgtcggcgc tggcggcgct cgggctgtcg       600
     atcgacgata tccgcaccgc catcggtacc gccaacgtca atggggccaa gggcagcttc       660
     gacggcccga tgcgcgcctc caccatcgac gccaacgacc agctcaagtc ggccgccgag       720
     tacagcaaga tgatcgtcgc ctacaagaac ggcgcgccca tccgcctgac cgacgtggcg       780
     cagatcgttg acggcgccga aaacagcaag ctggccgcct ggtccaacac cacccccgcc       840
     atcatcctga acgtgcaacg ccagcctggc gccaacgtga tcgaggtggt caaccgtgcc       900
     aaggcgctgc tgccacagtt gaaggaaacg ctgcccggca acgtagaggt atcgctgctg       960
     accgaccgca ccacgacgat ccgcgcctcg gtatcggatg tgcagttcga actgatgctg      1020
     gcggtggcgc tggtcgtgat ggtgatcttc ctgttcctgc gcaacgtgcc ggccacggtc      1080
     attccggcgg tggcggtgcc gttgtcgctg gtcggtacgt tcggcgtgat gtacctggca      1140
     ggcttttcga tcaacaacct cacgctgatg gcgctgacca tcgccaccgg cttcgtggtg      1200
     gacgatgcga tcgtcatgat cgaaaacatc gcgcgctaca tcgaagaggg tgacccgccg      1260
     atggaagccg cgctcaaggg gtccaagcag atcgggttca ccatcatctc gctcacgttc      1320
     tcgctcatcg cggtgctgat tccgctgctg ttcatgggcg atgtggtggg gcggctgttc      1380
     cgcgagttcg ccatcacgtt ggcggtatcg atcctgatct cggccgtggt gtcgctcacg      1440
     ctcacgccga tgatgtgcgc acgcttgctc aagcacattc ccgaagccga gcaatcgcgc      1500
     ttctatcacg ctgcgggcgc gttcttcgac aacgtcatcg cgcggtacgg ccgcatgctg      1560
     caatgggtgc ttgaccggca gaagacgacg ctgctggtgg ccatcggcac gctggtgctg      1620
     acggggctgc tgtatgtggt ggtgcccaaa ggcttcttcc cggtgcagga cacgggcgtg      1680
     atccagggca tttcggatgc gtcgcagtcg atttcgttct cggccatggc ggagcggcag      1740
     cagaagctgg ccgaggtggt gctgaaagac ccggcggtgg agagcctgtc gtcgttcatc      1800
     ggcgtggatg gcgtgaacac gacgctcaac agcgggcgca tgctgatcaa cctcaagccg      1860
     aaggatgaac gcgacgccga tgccaccgag atcatccagc gcctgcaacc cgaactggcc      1920
     aaggtggccg gtatctcgct gtacatgcag ccggtgcagg atctgacgat tgaagaccgc      1980
     gtcagccgca cgcagtacca attcacggtg gaagacccgg acccgaacaa cctatcgaag      2040
     tgggtgccca aactggttga acgcctgcag cagacccgcg agctgcgcga cgtggcgagc      2100
     gacctgcagg acaacggcct gcgcgcctac gtgcaggtcg accgcgacaa ggcggccgtg      2160
     tacggcatca cgatggcggc ggtcgacagc gtgctgtaca gcgcctacgg ccagcgcctg      2220
     atttcgacca tcttcacgca atcgaaccag taccgcgtgg tgctcgaaac ggacccgaag      2280
     atgcagctgg ggccgcaatc gctgtatgac ctgcacgtgg catcgagcag cggccagcag      2340
     attcccttgg gcgcgtttgc cacggtggtg gaacagccgg gctcgctcgt ggtgaaccat      2400
     cagggccaat ttccggcggc aaccatctcg ttcaacctgg cgccgcgtgc ctcgctaggc      2460
     gcggcggtcg acaccatcaa tgcggtcgaa gaggaaatcg gcttgccggc cagcatgcag      2520
     accagtttcc agggcgcggc gctggcgttc cgcgcgtcgc tgtcgaacca actgtggctg      2580
     atccttgcgg ccatcatcac gatgtacatc gtgctgggcg tgctgtacga aagcacgatc      2640
     cacccggtga cgatcctgtc gacgctgccg tcggccggcg tgggcgccct gctctcgctg      2700
     ctggtgtcgg gcaaggacat gggcatcatc gccatcatcg ggatcatcct gctgatcggt      2760
     atcgtcaaaa agaacgcgat catgatgatc gacttcgcgc tggaggccga gcgtgagcag      2820
     ggcatggctc cgcgcgacgc catctaccag gcgtgtctgc tgcgcttccg cccgattctg      2880
     atgacgacca tggccgccct gctgggtgcg ctgccgctga tgctgggcac aggcgtgggc      2940
     tccgagctgc gccagccgct agggatcacg atggtgggtg gcctgctggt cagccaggtg      3000
     ctgacgctgt tcaccacgcc ggtcatctat ctggccttcg acagcctggg cggacgcctg      3060
     cgtgactggc gcgcgcgccg cgccgcccga cgccacggtg ccgccggcgc caaccaatct      3120
     ggcgggcaac gatga                                                       3135
//

If you have problems or comments...

PBIL Back to PBIL home page