(data stored in ACNUC7421 zone)

EMBL: CP001069.PE414

CP001069.PE414       Location/Qualifiers
FT   CDS_pept        complement(470844..472196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4193"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: rso:RSp1189
FT                   probable high-affinity gluconate transporter (GNT-III
FT                   system) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4193"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29290"
FT                   /db_xref="GOA:B2UI89"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI89"
FT                   /protein_id="ACD29290.1"
FT                   /translation="MVPMQGNSLLLTAALAVVALIYLIAVQKLNPFVTLIVVSLVLGVV
FT                   VGMPMGNIVKAFETGVGNTLGHIALVVGLGTMLGKMMAESGGAERIAKTLISAFGEKNA
FT                   HWAMMVVAFIIGLPVFFEVGFVLLIPIAFNVAKRTGTPILLVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVTAYQADIGKTIMYALIVGLPTAILAGPLWAMLVSRYVKPDENNPLAAQFVE
FT                   ADQKRELPGFGVTLFTILLPVVLMLIGSWADLIVAPKTLANDILKLAGNSVMALLIAAI
FT                   VSFYTFGKARGFNRETILKFTNECLAPIATITLVVGAGGGFGQILRDSGVSKAIVAVAT
FT                   DAHLSPLLLGWVVAVLIRIATGSATVAMTTACGIVAPIAAASGAAVKPELMVLATGAGS
FT                   LILSHVNDGGFWLVKEYFNLTVPQTFKTWTVLETIISIVALLLTLALATVV"
     atggtcccga tgcaaggcaa ctcgctattg ctgaccgccg cgctagcggt ggtcgcactg        60
     atttacctga ttgctgtcca gaaactgaac ccgttcgtca cgctgatcgt cgtctcgctt       120
     gtgctgggcg tggtagttgg catgccgatg ggcaacatcg tcaaggcgtt cgaaaccggg       180
     gtgggcaaca cgctcggcca catcgccctt gtggtgggcc tcgggacgat gctcggcaag       240
     atgatggcgg aatcaggggg tgccgagcgc atcgccaaaa cgctcatcag tgcctttggc       300
     gagaagaacg cgcactgggc catgatggtc gtggcgttca tcatcggctt gccggtcttc       360
     tttgaagtcg gctttgtgct gctgatcccg attgcgttca acgtggccaa gcgcacgggt       420
     acgccgatcc tgctggtggg cctgccaatg gtggccggtc tgtcggtggt gcatggcctg       480
     atccccccgc acccggccgc gctgctggcc gtgacggctt accaggccga catcggcaag       540
     acgatcatgt atgcgctgat cgtcggcctg ccgactgcca tcctggccgg tccgctgtgg       600
     gcgatgctgg tctcgcgcta cgtcaagccg gacgaaaaca acccgctggc cgcccaattt       660
     gttgaagccg accagaagcg cgagctgccg ggctttggcg tgacgctgtt cacgatcctg       720
     ctgccggtgg tgctgatgct gatcggcagc tgggccgacc tgatcgtcgc gcccaagacg       780
     ctggcaaacg acatcctgaa gctggccggc aactccgtga tggccctgct gattgccgcc       840
     atcgtgagct tctacacgtt cggcaaggca cgcggcttca accgcgagac catcctcaag       900
     ttcaccaacg agtgtctggc accgatcgcc acgatcacgc tggtggtggg tgcgggcggc       960
     ggcttcggcc agatcctgcg tgattcgggc gtgtcgaagg ccatcgtggc cgtcgccacc      1020
     gatgcacatc tgtcgccgct gctgctgggc tgggtggtgg ccgtgctgat ccgtatcgct      1080
     acgggttcgg ccacggtggc catgacgacc gcctgcggta tcgtcgcccc gatcgccgcc      1140
     gcctcgggcg ccgccgtcaa gccggagctg atggtgctgg ccaccggcgc ggggtcgctg      1200
     atcctgtcgc acgtgaacga cggtggcttc tggctggtga aggagtactt caacctgacc      1260
     gtgccgcaga ccttcaagac gtggacggtg ctggaaacca tcatctcgat cgtcgcgctg      1320
     ctgctcacgc tggcgctggc gaccgtcgtt taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page