(data stored in SCRATCH zone)

EMBL: CP001069.PE415

CP001069.PE415       Location/Qualifiers
FT   CDS_pept        complement(472277..472663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4194"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS03132
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29291"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI90"
FT                   /protein_id="ACD29291.1"
FT                   /translation="MTITRIGVEGGTGTGGQHLPFARAAGADGWLFVSGQTPMVNGEVV
FT                   GNGIVEQSHQTIKNVLAILAEAGYGPEHVVRCGVWLDDPRDFQSFNKVFKEYFGANPPA
FT                   RACVVSSMVIDCKVEVDCVAYKKP"
     atgacgatta cccgaattgg cgttgaaggc ggcaccggca ccggtggcca gcacctcccc        60
     tttgcccgcg cagccggcgc agacggctgg ctgttcgttt cgggccagac gcccatggtg       120
     aacggcgagg tggtcggcaa cggcatcgtc gagcaatcgc accagaccat caagaacgtg       180
     ctcgccatcc tggccgaagc gggctacggg cccgagcacg tcgtgcgctg tggcgtgtgg       240
     ctggatgacc cgcgcgactt ccagtcgttc aacaaggtgt tcaaggagta cttcggtgcc       300
     aacccgcccg cgcgcgcctg cgtggtgtcg agcatggtca tcgactgcaa ggttgaagtc       360
     gattgcgtgg cgtacaagaa gccgtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page