(data stored in ACNUC7421 zone)

EMBL: CP001069.PE417

CP001069.PE417       Location/Qualifiers
FT   CDS_pept        complement(474191..475084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4196"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: rso:RS03130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29293"
FT                   /db_xref="GOA:B2UI92"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI92"
FT                   /protein_id="ACD29293.1"
FT                   /translation="MRDPKPDPMREPMDIVTRLSQRAAELRPAEQKVAQTVLSDIAEAA
FT                   AGSIQTLAERAGVSEASVTRFAKAMGCRDVRELKLKLAQAAAVGQRFLDGGADRPPSSA
FT                   DGILADISNVLEANRALVQPEAFRAAAVALVAARMIAVFGMGGGSTTMADEMRYRLARL
FT                   GRPVTTYHDSMLQRMVAATLSPDDVVVVFSVTGHVPEVIDSVTIAREYGARIVAITAIG
FT                   SPLAALADVLLPIQAMETDFIFKPSSSRYAMMMMIDLLATEVALQQADRSKELLRRIKY
FT                   VLDAHRGGGNRQPLGD"
     atgcgagacc ctaagcccga ccccatgcgt gaaccgatgg acatcgtgac ccgactctcc        60
     cagcgtgccg ctgaactgcg ccccgccgag cagaaggtcg cgcagaccgt cctgagcgac       120
     atcgcggagg ccgccgccgg cagcatccag acgcttgccg aacgcgccgg cgtgagtgag       180
     gctagcgtca cccgttttgc caaggcgatg ggctgccgtg acgtgcgcga actcaagctc       240
     aagctagcgc aggcagccgc agtcggccag cgctttctgg atggcggcgc ggaccgcccg       300
     ccgtccagcg cagacggcat cctggccgac atcagcaacg tgctggaagc caaccgcgcc       360
     ctggtgcagc cggaggcatt ccgcgccgcg gccgtcgcac tggtggcggc gcgcatgatt       420
     gccgtgttcg gcatgggcgg tggctcgacc accatggccg acgaaatgcg ctaccggctg       480
     gcccgcctgg gacggccggt caccacctat catgattcga tgctgcagcg gatggtcgcg       540
     gccacgctca gcccggacga tgtggtggtc gtgttttccg tgaccggcca cgtgccggag       600
     gtcatcgaca gcgtgaccat cgcgcgcgag tacggcgcca ggatcgtcgc catcacggcc       660
     atcggctcgc cgctggcggc gctggccgat gtcttgctgc cgatccaggc catggaaacc       720
     gatttcatct tcaagccgtc gtcatcgcgc tacgccatga tgatgatgat cgacttgctg       780
     gccaccgaag tcgcactgca gcaagccgat cgcagcaagg aactgttacg gcgcatcaag       840
     tacgtgctcg atgcgcatcg cggcggcggc aatcgtcagc cgctcggaga ttga             894
//

If you have problems or comments...

PBIL Back to PBIL home page