(data stored in ACNUC7421 zone)

EMBL: CP001069.PE418

CP001069.PE418       Location/Qualifiers
FT   CDS_pept        475223..476500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4197"
FT                   /product="putative D-serine deaminase (D-serine
FT                   dehydratase) protein"
FT                   /note="KEGG: rso:RSp1185 probable D-serine deaminase
FT                   (D-serine dehydratase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29294"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI93"
FT                   /protein_id="ACD29294.1"
FT                   /translation="MSDTKYQGDANAVVNPLDKGLGALEAACAPEQIAAQRWNVLNEDL
FT                   NLPAAVLSQSRVEHNLAWMQRFVSEYGAKLAPHGKTTMAPRLFQRQLAGGAWGITLATA
FT                   HQTRIAYAHGVRRVLMANQLVGKRNMAILAELLADPTFEFFCLVDAADQVDQLAAFFGK
FT                   TGRPIQVLIELGVQGGRTGVRDDAQLQSVLDALTRANGAVKLAGVEVYEGVIKEEADIR
FT                   TFLQRAVKVMGDLAKGGRLQRTPAVLTGAGSAWYDVVAEEFAKANIGQPLDVVLRPGCY
FT                   LTHDVGIYRAAQTRIDANNPIAHKMRSSLLPALQLWAYVQSVPEAERAIIAMGKRDAAF
FT                   DAGLPLPVLHFRPGDKTPSATPAHWEVTGMMDQHAYLKIAPGDDIKVGDMIAFDISHPC
FT                   LTFDKWRQISVVDDAYNVVDVVQTYF"
     atgagtgata caaagtacca aggagacgcc aacgctgtcg tcaacccgct cgacaagggc        60
     ttgggtgcgt tggaagccgc atgcgcgccg gagcagatcg ctgcccagcg ctggaatgta       120
     ttgaacgaag acctgaacct gcccgcagcg gtgctctcgc aatcccgcgt ggagcacaac       180
     ctggcgtgga tgcagcgctt cgtgagcgaa tacggcgcca aactcgcgcc gcatggcaag       240
     acgacgatgg cgccgcgcct gttccaacgt cagttggccg gcggtgcgtg gggcatcaca       300
     ctggcaacgg cgcaccagac gcgcattgcg tacgcccacg gcgtgcgtcg cgtgctgatg       360
     gccaaccagc tggtgggcaa gcgcaacatg gcgatcctcg ccgagttgct ggccgatccg       420
     acgttcgaat tcttctgcct ggtggatgcg gcggatcagg tcgatcagct tgctgccttc       480
     ttcggtaaga cggggcgccc gatccaggtg ttgatcgaac tgggcgtgca gggcggccgc       540
     acgggcgtgc gcgacgatgc gcaactgcaa tcggtgctcg atgcgctcac gcgtgccaat       600
     ggcgccgtca aactcgcggg cgtcgaagtc tatgaaggcg tgatcaagga agaagcggat       660
     atccgcacct tcctgcagcg cgccgtgaag gtgatgggtg atctggcaaa gggcgggcgc       720
     ctgcaacgca cgccggccgt gctgaccggt gccggttcgg cttggtacga cgtcgtggcc       780
     gaagagttcg ccaaggccaa tatcggccag ccgttggatg tggtgctgcg cccgggctgc       840
     tacctgacgc acgacgtggg catctaccgc gcggcgcaga cccgtatcga cgccaacaac       900
     ccgattgcgc acaagatgcg ttcgagcctg ctgcctgcgc tccagctttg ggcctatgtg       960
     caatccgtgc cggaggctga gcgcgccatc atcgcaatgg gcaagcgtga cgccgcattc      1020
     gacgcgggtc tgccactgcc agtgctgcat ttccgcccag gtgacaagac gccgtcagcc      1080
     acgccggcgc actgggaagt caccggcatg atggatcagc atgcctacct gaagatcgcc      1140
     cccggcgacg acatcaaggt cggcgacatg atcgccttcg acatctcgca cccgtgcctc      1200
     accttcgaca agtggcgcca gatttctgtc gttgacgacg cctacaacgt ggtcgacgtt      1260
     gtgcagacct acttctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page