(data stored in ACNUC7421 zone)

EMBL: CP001069.PE421

CP001069.PE421       Location/Qualifiers
FT   CDS_pept        complement(480464..482500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4200"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rso:RS05068 probable composite two-component
FT                   transcriptional regulatory (sensor histidine kinase and
FT                   response regulator hybrid) transcription regulator protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29297"
FT                   /db_xref="GOA:B2UI96"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI96"
FT                   /protein_id="ACD29297.1"
FT                   /translation="MTSILPSSSRPSDARAADPARLPDPGPFSKSGFNDAPAIRPSAWL
FT                   VAMGAAAVGTIGRLLLESAMGIHLPFYLAFPVVTIAAWYGGFWPGMLAIVCYAGLFIAL
FT                   AALQSWPAAVPLTPIQMTVFGVGALLICALCEQLRRARAGAERRARAETQQRLSQQRLL
FT                   AALQASPISLYDVDNTMHFTWVHNPVFGLQPEQLLGRTVREVFGRRAASRLTEAGQRVI
FT                   ATGTPTRVEFAFRRRHTQRVVYDVVVMPLRDDTGEIIGLTNAVIDISERRQAEARRTQL
FT                   LEAESRAREEAERASRLKDDFLATVSHELRTPLNAVLGWAQLLNMRAYDEAMFKRGIEA
FT                   IERSARTQVHLIDDLLDMSAILSGKVPLEIGPVDLADVLERARETIEPMARQKNITIET
FT                   EFLPVPMLQGDAGRLKQVFWNLLANAVKFTPEGGHIRLSVHPAPEGVVATVRDTGIGIE
FT                   PTFLPHIFDRFQQADLSSTRRHGGLGLGLAIAKQLVELHHGRITAASSGADRGTTMAVS
FT                   LPLHAAQPGEQANRTPGLVAGTGVPTLDGIRVLAVDDNPESLGVIALMLERYGADVVTV
FT                   SSGAAALDALEHAVANAYPFDALVSDLAMPGMDGMQLVRAVRERGWTDLPAIAVTAFAD
FT                   PIRLKAAKEAGYQSVITKPIFPGELGHVLAANVHRKTGPETLV"
     gtgacgtcca tcctgccctc atcttcccgc ccgtcggacg cgcgcgctgc tgaccctgcc        60
     cggttgccgg accctgggcc cttcagcaag agcgggttca acgatgcccc ggccattcgt       120
     ccatcggcat ggctggtggc gatgggtgcg gccgccgtcg gcacgattgg gcggttgctg       180
     ctcgaatcgg caatgggcat ccatttgccg ttctacctgg cctttccggt ggtaacaatt       240
     gccgcgtggt atggcggctt ctggccgggg atgctggcca tcgtctgcta tgcggggctg       300
     ttcatcgcat tggctgcact gcaaagctgg cctgccgctg tgccgctcac gccgatccag       360
     atgacggtgt ttggggtggg cgcactgctt atctgcgcct tgtgcgagca gttgcgtcgt       420
     gcccgcgccg gggctgaacg gcgcgcgcgg gccgaaaccc agcaacgcct gtcgcagcaa       480
     cgcctgctgg ccgcgctgca ggcttcgccc atttcgctct acgacgtcga caacacgatg       540
     cacttcacgt gggtgcacaa ccccgtgttc ggcctgcagc ccgagcagtt gctgggacgg       600
     acggtgcgcg aagtgttcgg ccgccgcgct gcatcgcgcc tgaccgaagc cggccagcgc       660
     gtcatcgcaa cgggcacgcc tacgcgcgtg gagttcgcgt tccggcggcg ccacacgcag       720
     cgcgtggtct acgacgtggt ggtcatgccg ctgcgcgacg acaccggcga gatcatcggc       780
     ctgacgaacg ccgtgatcga catcagcgaa cgccgccagg ccgaggcccg ccgcacgcag       840
     ttgctcgaag ccgaatcccg cgcccgcgaa gaggccgagc gcgccagccg cctgaaagac       900
     gacttcctgg cgaccgtcag ccacgagctg cgcacgccgc tcaatgcggt gctgggctgg       960
     gcgcaattgc tgaacatgcg cgcgtacgac gaagcgatgt tcaagcgcgg cattgaagcc      1020
     atcgagcgca gcgcccgcac gcaggtccac ctcatcgacg acctgctcga catgtcggcc      1080
     atcctttcgg gcaaggttcc actggagatt ggccccgtag atctggccga cgtgctggaa      1140
     cgcgcgcgcg agaccatcga gccgatggcg cgccagaaga acatcaccat cgagaccgaa      1200
     ttcctgcccg tgccgatgct gcaaggcgat gccgggcgcc tgaagcaggt gttctggaac      1260
     ctgctggcca atgccgtcaa gttcacgccc gagggcggcc acatccggct ctcggtgcat      1320
     ccggcgcccg aaggcgtggt cgccaccgtg cgcgacaccg gcatcggcat cgagcccacc      1380
     ttcctgccgc atatttttga tcggttccag caggcggacc tgtccagcac gcgtcggcac      1440
     ggcgggctcg ggctggggtt ggcgattgcc aaacaactcg tcgaactgca ccacggccgc      1500
     atcacggcag ccagcagcgg tgcggaccgt ggcaccacca tggccgtgtc gttgccgctg      1560
     catgccgcgc agccgggcga acaggccaac cgcacgccgg gcctcgtcgc ggggacgggc      1620
     gtgccgacac tggacggcat ccgcgtgctg gcagtggatg acaaccccga gtcgctcggc      1680
     gtgatcgcgc tgatgctcga gcgctacggg gccgacgttg tcaccgtatc cagcggggcg      1740
     gccgcactcg atgcgctgga acatgcagtc gccaacgcct acccgttcga tgcgctggtc      1800
     agcgacctcg ccatgccggg catggacggc atgcagttag tgcgggccgt gcgcgaacgc      1860
     ggttggaccg acctgcccgc catcgcagtg acggcatttg ccgacccgat ccgcctgaag      1920
     gcggcgaagg aggccgggta ccaatccgtc atcaccaagc cgattttccc gggcgaactg      1980
     ggccacgtgc tggccgccaa tgtgcatcgc aagaccgggc ctgaaacgct ggtgtga         2037
//

If you have problems or comments...

PBIL Back to PBIL home page