(data stored in SCRATCH zone)

EMBL: CP001069.PE422

CP001069.PE422       Location/Qualifiers
FT   CDS_pept        complement(482652..483950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4201"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RS05067 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29298"
FT                   /db_xref="GOA:B2UI97"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI97"
FT                   /protein_id="ACD29298.1"
FT                   /translation="MSGDAGLSPASSSASAQTLSHAPFSYPAFRLFWFARLSTTFAYQM
FT                   FGVAVGWQIYDLTRSAYVLGLVGLAQFLPSVVLVLASGHIADRYDRRYVVRACQAIEAL
FT                   VALALAVMAANGHAGVQPIFLCVVVIGAMRAFETPTLQALLPTLVPLQALPRAVALSSS
FT                   AGQTGVILGPALGGFLYVAGAPVVYATAAGLFLLAHVLLALVRMERAAPVSTPVSLESL
FT                   FAGIAFIKGRPVVLGAISLDLFAVLLGGATALLPIYARDILGTGAWGLGLLRSAPAVGA
FT                   LGMALFLAHRPLDRHVGRVMFAAVAVFGLATLVFGVSHWLPLSMLALVLLGASDMISVV
FT                   IRTSLVQLDTPDAMRGRVSAVNSVFVGASNQLGEFESGMLAGLLGPVASVVIGGLGTLL
FT                   VVAAWMRLFPALAQRDRMRDPHPADAGHPSSGG"
     gtgtctggcg acgccggtct ttcccccgct tcctcttccg catctgcgca aacgctgtcg        60
     catgcgccgt tttcctatcc cgcgttcagg ctgttctggt tcgccaggct gtccaccacc       120
     ttcgcgtatc agatgttcgg ggtggccgtc ggctggcaga tctacgacct cacgcgcagc       180
     gcctatgtgc tggggctggt cgggctggcg cagtttctgc cgtcggtggt gctggtgctg       240
     gcctccggcc atattgcgga ccgctacgac cggcggtacg tcgtgcgcgc ctgccaggcc       300
     atcgaagccc tggtggcgct cgcgctggcc gtcatggcag ccaatgggca cgcaggcgtg       360
     cagccgatct tcctgtgcgt ggtggtgatt ggcgcgatgc gagcgttcga gacgccgacg       420
     ctgcaagcgc tgttgccgac gctggtgccc ctgcaggcat tgccgcgcgc ggtggcgctg       480
     tccagttcgg ccgggcagac cggcgtgatc ctgggaccgg cgctgggcgg ctttctctac       540
     gtggcaggcg cgccggtggt gtatgccacg gcagcagggc tgttcttgct cgcgcacgtg       600
     ttgctggcgc tggtacggat ggagcgggcg gcgcccgtca gcacgccggt cagcctcgaa       660
     tcgctgttcg cgggtattgc gttcatcaag gggcggccgg tggtgctggg cgccatctcg       720
     ctcgacctgt ttgcggtact gctgggcggc gcgacggcgc tgctgccgat ctacgcgcgc       780
     gacatccttg gcacaggcgc atgggggctg gggctgctgc gctcggcgcc ggcggtgggg       840
     gcgctgggca tggcgctttt cctggcgcac cgtccgctgg atcggcacgt cggccgggtg       900
     atgtttgccg ccgtggcggt gttcgggctg gcgacgctgg tatttggggt gtcgcactgg       960
     ctgccgctgt cgatgctggc gctggtgctg ctgggggcgt ccgacatgat cagtgtggtg      1020
     atccgcactt cgctggtgca gctcgatacg cccgatgcca tgcgcgggcg cgtgagcgca      1080
     gtcaattccg tgttcgtggg cgcgtccaac cagttgggcg aattcgaatc gggcatgctg      1140
     gcggggctgc ttgggccggt ggcctcggtg gtgattggcg gcctcggcac gctgttggtg      1200
     gtggcagcct ggatgcggct gttcccggcc ctggcgcaac gcgaccgcat gcgcgatccg      1260
     cacccggcgg atgccggaca cccctcttca gggggataa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page