(data stored in ACNUC7421 zone)

EMBL: CP001069.PE423

CP001069.PE423       Location/Qualifiers
FT   CDS_pept        484103..484459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29299"
FT                   /db_xref="InterPro:IPR021513"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI98"
FT                   /protein_id="ACD29299.1"
FT                   /translation="MATHNARSKPAPPRSTAKPKNHRWSRHVMETSDALDIEPDIFKLR
FT                   SPARIAASLKASAEHSRRRKGTAFQSAMSMLTFYINRAAHNLSGGRRRILERAKDALRA
FT                   EFGRRAQSTAKARH"
     atggccacgc acaacgcccg gtcaaagccg gcgccgccca gatcgacggc caagccgaag        60
     aaccaccgtt ggtcgcgcca cgtcatggag accagcgacg cgctggacat cgaacccgat       120
     atcttcaagt tgcgcagccc cgcgcggatt gcggcgtcgc tcaaggcatc ggccgagcat       180
     agccggcggc gcaaggggac ggcattccag tcggccatgt caatgctgac gttctatatc       240
     aatcgggcgg cgcacaacct cagcggcggg cgtcgccgga ttctggaacg tgccaaggat       300
     gctctgcgag ccgaatttgg ccgccgtgcc caaagcacgg ccaaggcccg gcattga          357
//

If you have problems or comments...

PBIL Back to PBIL home page