(data stored in SCRATCH zone)

EMBL: CP001069.PE426

CP001069.PE426       Location/Qualifiers
FT   CDS_pept        complement(485424..487586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4205"
FT                   /product="acid phosphatase"
FT                   /note="TIGRFAM: acid phosphatase; PFAM: phosphoesterase;
FT                   KEGG: rso:RSp1174 putative acid phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29302"
FT                   /db_xref="GOA:B2UIA1"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017768"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA1"
FT                   /protein_id="ACD29302.1"
FT                   /translation="MSRALRLLPLTALVAASMSACGGSDSNSSASASTSGVVTGSYFEH
FT                   AKVCIDANNNGKCDSGEASTYTDANGAYSLSGTGAITVEIGTDAFRNDPDKGTHTAITQ
FT                   PLVFRAPAGANAVVSAISTELAVLMDSNGGDINAAKTALAARLGVTIDKLLEDHNKETD
FT                   ADTKTALQAEIDQAIDLIADAVANGGDIDKRLHDGVTKRMALANNVKTIVVIYAENRGF
FT                   DNLYGLFPGANGIPGVNPTSTGTAVAQKDFDGSVLPTLPPTWGGVTAAGQSVQITQAST
FT                   ANMPNQMFQIDSPSGFGSTGTVVGQNVITRDLWHRFYQNQMQINGGKNDKFAAFADAGG
FT                   LTMGYYDGSKMAMWNIAKQYTLADNFFMGAFGGSFLNHQYLVCACAPIYPNAKASPAVN
FT                   SIANVKTNADGSPTLIPAASSVMAGAPTSYAGAGDDGNPTKDGSLTPVDSNGNSYAVNT
FT                   MQPPYQPSGNAVASGNAAYADPTKASTMPKQSTTNIGDLLTARGVDWAWYAGAWNAAIA
FT                   DAPNTTRSVIYSGAIQFQPHHQPFNYFSRFDPATTTGAAERAAHLRDYDAAFLQDAAAG
FT                   KLPAVTFYKPQGNLNQHPGYANVADGDAHIVNVIAQLQKSPQWKNMVIVVTYDENGGFY
FT                   DHATVPKADRWGPGTRIPAIIVSPFAKKGFVDHTQYDTASVLRLITHRFDLPTLPGIKQ
FT                   RDDALVSNGNKPMGDLTNALDFTQAQ"
     atgagccgag cgcttcgtct tttgccgctg accgcgttgg ttgctgccag catgtctgcc        60
     tgtggtggca gtgattcgaa cagcagtgcc tccgcgtcca cctctggcgt ggtgaccggc       120
     agctacttcg aacatgccaa agtttgtatc gacgccaaca acaacggcaa gtgcgattcg       180
     ggtgaagcca gcacctatac cgatgccaac ggcgcgtact cgctgtcggg cacgggcgcc       240
     atcaccgtgg aaatcggcac ggacgctttc cgcaacgacc cggacaaggg tacgcatacg       300
     gccatcacgc agccgctggt gttccgcgca ccggccggtg ccaatgctgt tgtcagcgcc       360
     atctcgaccg aactggcggt gctgatggac agcaacggcg gtgacatcaa cgctgccaag       420
     acggcactgg ccgctcgcct tggcgtgacg atcgacaagc tgctggaaga ccacaacaag       480
     gaaaccgacg ctgacaccaa aactgcgctg caggctgaga tcgaccaggc catcgatctg       540
     atcgctgacg ccgttgccaa tggtggcgac atcgacaagc gcctgcacga cggggtgacc       600
     aagcgcatgg cgctggcaaa caacgtcaaa acgatcgtgg tcatctacgc agaaaaccgc       660
     ggtttcgaca acctgtacgg cctgttcccg ggcgccaatg gcatccccgg tgtgaacccg       720
     acctcgacgg gcactgccgt tgcgcagaaa gacttcgacg gctccgtgct gccgacgctg       780
     ccgcccacct ggggtggcgt gaccgccgcc ggccagagcg tgcagatcac gcaggcttcc       840
     accgccaaca tgccgaacca gatgttccag atcgacagcc cgtcgggctt cggcagcacg       900
     ggcacggtgg tcggccagaa cgtcatcacg cgtgacctct ggcaccgctt ctatcagaac       960
     cagatgcaga tcaacggcgg caagaacgac aagttcgccg cctttgccga tgccggcggc      1020
     ctgaccatgg gctactacga cggcagcaag atggccatgt ggaacatcgc caagcaatac      1080
     acgctggcgg acaacttctt catgggcgcc ttcggcggtt cgttcctgaa ccaccagtac      1140
     ctggtctgcg cgtgcgcacc gatctacccg aacgcaaagg cgtcgccggc ggtcaacagc      1200
     attgccaacg tcaagacgaa tgcagacggc agcccgacgc tcatcccggc tgcaagctcg      1260
     gtgatggccg gtgcgccgac ctcatacgca ggcgctggcg acgatggcaa tcccacgaag      1320
     gacggcagcc tgacgccggt cgacagcaac ggcaactcgt acgccgtcaa cacgatgcag      1380
     ccgccgtacc agccctcggg caacgccgta gccagcggca acgcagccta tgctgatccg      1440
     accaaggcgt cgacgatgcc gaagcagtcg accaccaaca tcggtgacct gctgaccgcc      1500
     cgtggcgtgg actgggcctg gtacgccggc gcctggaacg cggccatcgc cgacgctccg      1560
     aacaccacgc gcagcgtgat ctacagcggc gcgatccagt tccagccgca ccaccagccg      1620
     ttcaactact tcagccgctt cgacccggcc acgaccaccg gcgccgccga gcgtgcggcc      1680
     cacctgcgcg actacgacgc cgccttcctg caagacgcag ccgcaggcaa gctgcccgcc      1740
     gtcacgttct acaagccgca aggcaacctg aaccagcacc cgggctacgc caatgtggct      1800
     gacggcgacg cgcacatcgt caacgtgatc gcccagctgc agaagagccc gcagtggaag      1860
     aacatggtga tcgtcgtgac gtatgacgaa aacggtggct tctacgacca cgccacggtg      1920
     ccgaaggccg accgctgggg cccgggcacg cgtatcccgg cgatcatcgt ctcgccgttc      1980
     gccaagaagg gtttcgttga ccacacccag tacgacacgg cttcggtcct gcgcctgatc      2040
     acgcaccgct tcgacctgcc gacgctgccg ggtatcaagc aacgtgacga cgcgctcgtc      2100
     tccaacggca acaagccgat gggcgacctg accaacgcgc tggatttcac gcaggctcaa      2160
     taa                                                                    2163
//

If you have problems or comments...

PBIL Back to PBIL home page