(data stored in SCRATCH zone)

EMBL: CP001069.PE429

CP001069.PE429       Location/Qualifiers
FT   CDS_pept        complement(490953..491870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4208"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rme:Rmet_0006 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29305"
FT                   /db_xref="GOA:B2UIA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA4"
FT                   /protein_id="ACD29305.1"
FT                   /translation="MSKLSNRLEGCLYLALAMVLVGSTVAASKIIAAGLPPFTATALRF
FT                   AMALPMFLVIMRMTRTRWPVLARRDWVLLFLQAAAGSVGYTTLLISGLRHTSAADAGVI
FT                   VGTLPVMSALIAIVLLGERPGRAVLGAIGLATAGVLAIALQPRGDATHPLLGNLLVMGA
FT                   VVCEGLFILLNKRLRTPVPPLALSALMSAFGLLTALVPALWEAPWQLHASVQTTHALMA
FT                   VAYYAIVPTVGGFMLWYTGAARVSGAEASLFTALAPVAAVLFAATLLGEAVSTRQVGGI
FT                   ACVLAGVLSLGLARAPRPLSSTTS"
     atgtcaaaac tgtccaatcg actcgaaggc tgcctctacc ttgcgctggc catggtgctg        60
     gtgggcagca ccgtggccgc cagcaagatc atcgcggcgg gcttgccgcc ctttacggcg       120
     acagcgttgc gctttgcgat ggcgctgccg atgttcctcg tcatcatgcg catgacccgc       180
     acgcgctggc ccgtgcttgc acgccgcgat tgggtactgc tcttcctgca ggcagccgcc       240
     ggcagcgtgg gctatacgac gctgctcatt tcgggcctgc ggcacacgtc agcggcagat       300
     gcaggcgtca tcgtcggcac gctgccggtc atgtcggcgc tcatcgcgat cgtgctgctg       360
     ggcgaacgac ccggccgcgc ggtgctgggg gcgattgggc tggccaccgc cggcgtgttg       420
     gccatcgccc tgcagccgcg cggcgacgcg acacatccgc tgctcggcaa cctgctggtg       480
     atgggcgccg tggtgtgcga ggggctcttc atcctgctca acaagcggct gcgcacgccg       540
     gtgccgccgc ttgcgctgtc ggcattgatg agtgcgttcg gtttgctgac ggcgctggtg       600
     cccgcgctgt gggaagcgcc ttggcagttg cacgcatcgg tgcagacaac gcacgcgctg       660
     atggcggtgg cctactacgc catcgtgccg acagtcggtg gtttcatgct ctggtatacc       720
     ggggctgcgc gcgtcagcgg tgcggaggca tcgctgttca ccgcgctggc acccgtggca       780
     gccgtgctgt tcgcagcaac gctgctcggc gaggccgtca gcacgcgtca ggtaggcggc       840
     attgcgtgcg tgctggcagg tgtgctcagc cttggtttgg cgcgcgcacc aaggccgctt       900
     tcatcgacga cgtcttag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page