(data stored in SCRATCH zone)

EMBL: CP001069.PE431

CP001069.PE431       Location/Qualifiers
FT   CDS_pept        493003..494559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4210"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rso:RS05645 probable
FT                   two-component sensor histidine kinase transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29307"
FT                   /db_xref="GOA:B2UIA6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA6"
FT                   /protein_id="ACD29307.1"
FT                   /translation="MRPSFGITPKLFVALFMLSIFVALAMGTAVRWRFDANFLDYVNAR
FT                   ESERMTVLAQSVEAAYTQHGGWDFLRDDRMAWFRLLRREGARARANGMGGDRFDLPPGH
FT                   RFEPLPPGADRGMDRDMPPPPGPPPAGSMPPHPADEPPMPHSPIWLFDAQRNVIIGDGL
FT                   PLGPNARWQELHHNGQTVGWLAMPPRVRVPEGADQAFQVQQLRATWIIAGLSVLLAAFM
FT                   AVLLARGLLAPMRRLTDAARRMADGDYATRVDVHSRDELGGLAADFNHLAASLEANQKM
FT                   RRQLTADISHELRTPLAVLRGELEALEDGVRPLTATSLASLQAEVSTLSKLIDDLYELS
FT                   LADVGALAFHMEPLDLADTVCGAVQGFTPRLMEKGIALQLDVSAAPSHATMVKGDAQRL
FT                   RQVMQNLLENTLRYTDAGGTLRVHVHQEDDWQQIDVQDSAPGVPETMLPRIFDRLFRVD
FT                   ASRSRAQGGAGLGLSLCQTIVAAHGGTIEARHSPLGGLWIAIRLPVLDVLDPLADHDSD
FT                   H"
     atgcgaccgt ctttcggtat cacccccaag ctgttcgttg cgttgttcat gctgagcatc        60
     tttgttgcgc tcgccatggg cacggcggtg cgctggcggt ttgacgccaa ctttctcgac       120
     tacgtgaacg cgcgcgaatc cgagcgcatg accgtgctcg cgcaaagcgt ggaggccgcc       180
     tacacgcagc acggcggctg ggatttcctg cgcgacgatc gcatggcgtg gttccgcctg       240
     ctgcgccgcg aaggcgcccg ggcccgcgcc aacggcatgg gcggcgaccg cttcgacctg       300
     ccaccgggcc atcgcttcga gccgctccca cccggcgccg accgtggcat ggacagagac       360
     atgccgccgc cgcccggccc gcctcccgca ggcagcatgc cgccgcaccc ggccgacgag       420
     ccgccgatgc cgcactcgcc gatctggctg tttgatgccc agcgcaacgt catcattggc       480
     gacgggctgc cgctgggccc aaacgcgcga tggcaggaac tgcaccacaa cggccagacc       540
     gtcggctggc tggccatgcc gccgcgcgta cgggtgcccg aaggcgccga ccaggcattc       600
     caggtgcagc agttgcgcgc cacgtggatc atcgcggggc tgtcggtcct gctggcggcg       660
     ttcatggcgg tgctgctcgc acgcggtctg ctggccccga tgcgccggct gacggatgcc       720
     gcgcgccgca tggccgacgg cgactacgcc actcgtgtcg acgtgcattc gcgcgatgaa       780
     cttggcgggc tcgcggcgga tttcaaccac cttgccgcgt cgctggaggc caaccagaag       840
     atgcgccgtc agctcacggc cgatatctcg cacgagctgc gcacgcccct ggccgtgctg       900
     cgcggcgaac tggaagcact ggaagacggc gtgcgcccgt tgacggccac ctcgctcgcg       960
     tcattgcagg ccgaggtgtc gacgctcagc aagctcatcg acgacttgta cgaactctcg      1020
     ctggccgatg tgggggcgct tgctttccac atggagccgc tcgacctggc cgataccgtg      1080
     tgcggcgccg tgcaaggctt cacgccacgc ctgatggaaa agggcattgc gctgcagctg      1140
     gatgtgtcgg cagcgccgtc gcatgccacg atggtcaaag gcgatgcgca gcgcctgcgg      1200
     caggtcatgc agaacctgct ggaaaacacc ctgcgctata ccgatgccgg cggcacgctg      1260
     cgcgtgcatg tccatcagga agatgactgg cagcagatcg acgtgcagga cagcgcgccg      1320
     ggcgtgcccg aaacgatgct gccgcgcatc ttcgatcgcc tgttccgggt ggatgcctcg      1380
     cgcagccggg cacaaggcgg ggcgggcctc ggattgagcc tgtgccagac catcgttgct      1440
     gcacacggcg gcaccattga agccagacat tcgccgttgg gcgggctgtg gatcgccatc      1500
     cgcctgcctg ttcttgatgt gcttgatccg ctagccgacc atgattctga tcattga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page