(data stored in SCRATCH zone)

EMBL: CP001069.PE432

CP001069.PE432       Location/Qualifiers
FT   CDS_pept        494543..495202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4211"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rso:RS05646 probable
FT                   two-component response regulator transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29308"
FT                   /db_xref="GOA:B2UIA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA7"
FT                   /protein_id="ACD29308.1"
FT                   /translation="MILIIEDEPKLAALMTDYLRAAHYETEWLADGTHAAQRIRETAPE
FT                   LVLLDLMLPGKDGLEICREVRAFSEVPIVMVTARVEEIDRLLGLELGADDYVCKPFSPR
FT                   ELVARIKTILRRVQRGGGVPESALHIDAAAYAATLRGQRLDLTPVEFRLLAALAGAPGR
FT                   ILSRSNLLEQIYDDHRIVTDRTVDTHIKNLRRKMEQVSPGTEMIHSVYGVGYRLDA"
     atgattctga tcattgaaga cgaacccaag ctggctgcat tgatgaccga ctatctgcgc        60
     gccgcccact acgagaccga gtggctggcc gatggcacgc acgcagcgca gcgcattcgc       120
     gagacggcac ccgaactcgt gctgctcgac ctcatgctgc ccggcaagga cggcctggag       180
     atctgccggg aggtgcgcgc cttcagcgag gtgcccatcg tcatggtgac ggcgcgcgtg       240
     gaagaaatcg accgcctgct cggccttgag ctgggcgccg acgactacgt ctgcaagccc       300
     ttcagcccgc gcgaactggt ggcgcgcatc aagaccatcc tgcggcgcgt acagcgcggt       360
     ggcggcgtgc cggagagcgc gttgcacatc gatgctgctg cctatgccgc cacgctgcgc       420
     ggccagcgcc tcgacctcac gccggtggaa tttcgcctgc tggccgcgct tgcgggcgca       480
     ccggggcgca tcctctcacg ctcgaatctg cttgagcaga tctacgacga ccaccgcatc       540
     gtgaccgacc gcacggtcga tacgcacatc aagaatctgc gccgcaagat ggagcaggtg       600
     agcccgggca ccgagatgat ccattccgtc tatggcgtgg gttaccggct cgacgcctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page