(data stored in ACNUC7421 zone)

EMBL: CP001069.PE433

CP001069.PE433       Location/Qualifiers
FT   CDS_pept        495308..495880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4212"
FT                   /product="putative lipoprotein signal peptide"
FT                   /note="KEGG: rso:RS05425 probable lipoprotein signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29309"
FT                   /db_xref="GOA:B2UIA8"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA8"
FT                   /protein_id="ACD29309.1"
FT                   /translation="MIAVTSRRLVAVVAGLVFSCAAVAQTAAPGAAPLSPMQPVPPHGP
FT                   GMVGRGPGPAFGPGGPHAMGPHHGGAPFLRGLTLTEAQRDKIFAIEYAQMPEAREQHKA
FT                   IEHARRDLHQMVASGQYDEARARGLTESLGRAVAREAQLRAQAGAKVMQVLTPEQRKQV
FT                   ADREARRVAERPLEYDESAPPPELAAM"
     atgatcgctg tgacttcccg ccgcctggtc gccgttgttg ccgggcttgt tttctcatgt        60
     gccgcggtgg cccagactgc cgcaccgggc gcggctccgc tctcgccgat gcagccagtg       120
     ccgccgcacg gccccggcat ggtggggcga gggccgggcc ccgcgttcgg cccaggcggt       180
     ccgcacgcca tgggcccgca tcatggtggc gcgcctttcc tgcgcggcct caccctgact       240
     gaagcgcagc gcgacaagat cttcgccatc gaatatgcgc agatgccgga agcacgcgag       300
     cagcacaagg ccatcgagca tgcccgccgc gatctgcatc agatggtggc atcgggccaa       360
     tacgacgaag cgcgggcacg cggtctgacc gaatcgctgg gccgcgccgt ggcccgcgaa       420
     gcgcaactgc gtgcgcaggc cggcgccaag gtcatgcagg tgctcacccc tgagcagcgc       480
     aagcaggttg ccgatcgtga ggcccggcgt gttgccgaac gcccacttga atatgacgaa       540
     agtgctccgc cgccggaact ggctgcgatg taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page