(data stored in ACNUC7421 zone)

EMBL: CP001069.PE438

CP001069.PE438       Location/Qualifiers
FT   CDS_pept        499011..501761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4217"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rso:RS05432 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29314"
FT                   /db_xref="GOA:B2UIB3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB3"
FT                   /protein_id="ACD29314.1"
FT                   /translation="MTQFLPAQAGASPADVAPSPEAAQRPVAVTAGAMAEGRNTDFDAL
FT                   SRLSSDAVLLTVDGRLVQANPAAARLLGAQDPAQLAGLQLAGLIHPDDVAQVVPRLAGM
FT                   VSSGVSAQPVEHRLVRADYTHVLVASEAAACEHEGQPAVMLVLREAVSRHALERHAVQA
FT                   RAEALHARRLLASENAVLAQLASNATLSTVLRHLCLYVEQVYPNAMSALLLLDAGSQTL
FT                   RVAAAPTLPAAYAATLENSPVGPEAGACGCAMYLGDTVFIDSIATDPRWQRERTAALAA
FT                   GFASAWALPIRSSRGDKLGVLALFYRQPCMPVEEEQHFLDDVTHLAGVAIQKDNVERGL
FT                   AESEERYRLAISNLHEGVVIISPDGVVQAANASAERILRVRPGQLVGRNRLDPIQRVVD
FT                   EYGKEIGSTMMPSGQVLRTGEPIFGRVYGLLLKTGELMWVRQNIIPIRRHAEPTPSSVM
FT                   LSFADITDIKRAEQRLRHLAAHDALTGLTNRSFFIAHLESAIESARDESRELALFFLDL
FT                   DRFKSVNDTAGHACGDTLLQSAAARLTDCIGPGDVIARLGGDEFVILIDQRVEGKRIAL
FT                   LAERLLQAMREPFDTVNGRYYLGVSIGVALYPHDGISGSDLLRSADAAMYRAKQNGRNR
FT                   AQFYTAELNARLQRRYMLENALRDARENNELQLVYQPKYDLASHRIVGAEALLRWNSAK
FT                   LGAISPVEFIPVAEETGLIVPIGAWVLRRACEQAVIWYEALGYDFRMAVNLSARQFQAG
FT                   DVVPMIEQTLADSGLPPTALEVEITESLLMGGADEVRPMFDALTAQGIRISIDDFGTGY
FT                   SSLSYLQRFPISNVKIDRSFITGIPHDPDSVALTEAIVAMARALGMTVTAEGVEDADQV
FT                   EFLAKAGCQEIQGYYIGKPVTAEGFDRLLRAHLSVVDAGVRAALG"
     atgacccagt tccttccggc tcaggccgga gcctctcctg cagacgttgc gcccagcccc        60
     gaggccgccc aacgtccggt ggcggttacg gccggggcga tggccgaagg gcgtaatacc       120
     gatttcgacg cgctgtcgcg gctgtcgtcc gacgcggtat tgctgaccgt ggatgggcgc       180
     ctggtgcaag ccaacccggc cgctgcccgt ctgctgggcg cgcaggatcc agcgcaattg       240
     gcaggcctgc aactcgccgg cctgattcat cccgatgacg ttgcccaggt ggtgccgcgc       300
     ctggcgggca tggtgagcag cggcgtgtct gcccagcccg tcgagcaccg tctcgtgcgt       360
     gccgactaca cgcatgttct ggttgccagc gaagccgccg cgtgcgagca cgaaggccag       420
     cccgccgtca tgctcgtgct gcgcgaagcc gtgtcgcgcc atgcgttgga gcgacacgcc       480
     gttcaggcgc gcgccgaggc gctgcatgcg cgccgcctgc tcgcttcgga gaatgccgtg       540
     cttgcgcaac ttgcctccaa cgcgacactg tcgaccgtgc tgcgccacct gtgcctgtac       600
     gtcgagcagg tctacccgaa tgccatgtcg gcgctgttgt tgctggatgc aggctcgcag       660
     accctgcgtg tggccgctgc acccacgttg cctgcggcct atgccgccac gctggaaaac       720
     tcgcctgtcg gtcccgaggc gggcgcatgc ggttgtgcca tgtacctggg cgacaccgtg       780
     ttcatcgaca gcattgcgac cgacccgcgc tggcagcggg agcgcacggc agcactggcg       840
     gcgggttttg cttccgcctg ggcgttgccg atccgttcat cgcgcgggga caagcttggt       900
     gtgctcgcgc tgttctatcg acagccgtgc atgcccgtgg aagaagaaca gcatttcctt       960
     gacgacgtca cgcacctggc gggcgttgcc atccagaaag acaacgtcga acgtggtctg      1020
     gccgaaagcg aagagcgcta ccggctggcg atttcgaacc tgcacgaagg cgtcgtcatc      1080
     atatcgccgg acggtgtggt gcaggccgcc aacgccagcg ccgagcgaat cttgcgcgtc      1140
     cgcccggggc agcttgtcgg gcgtaaccgg ctcgacccga ttcaacgcgt ggtggacgaa      1200
     tacggcaagg aaatcggttc gaccatgatg ccgtccgggc aggtgctgcg cactggcgag      1260
     cccatcttcg gccgcgtcta cgggctgttg ctcaagacgg gcgaactgat gtgggtgcgg      1320
     cagaacatca ttccgatccg tcgtcacgcc gagcccacgc ctagcagcgt gatgctgtcg      1380
     tttgccgata tcaccgacat caagcgcgcc gagcagcgcc tgcgccatct ggccgcgcac      1440
     gacgcgctca cggggctgac caaccgcagc ttcttcatcg cgcacctgga aagcgccatt      1500
     gagagcgcgc gcgacgagag ccgcgaactg gcgctcttct tcctcgacct tgaccgcttc      1560
     aagagcgtga acgacaccgc gggccatgcc tgcggcgaca cgctgctgca gagcgcggcc      1620
     gcacgcctga ccgactgcat cggccccggc gacgtgatcg cccgtctggg cggcgacgag      1680
     ttcgtcatcc tcatcgacca gcgtgtcgag ggaaagcgga ttgccttgct ggctgagcgc      1740
     ttgctgcagg ccatgcgcga gccgttcgat accgtcaacg ggcggtatta cctgggcgtg      1800
     tcgattggcg tggcgctgta tccgcacgac ggcatttcgg gttccgacct gctacgttcg      1860
     gctgacgccg ccatgtaccg ggccaagcag aacggccgta accgtgcaca gttctacacg      1920
     gctgaactga acgcccgcct gcaacgtcgc tacatgctgg aaaacgcgct gcgtgacgcg      1980
     cgcgagaaca acgagctgca gctcgtctat caacccaagt acgacctggc cagccatcgc      2040
     atcgttggcg ccgaggcgct gctgcgctgg aacagcgcca agctcggagc gatctcgccg      2100
     gtggagttca ttccggtggc ggaagagacg gggctgatcg tgccgattgg cgcatgggtc      2160
     ctgcgccgtg cctgcgagca ggccgtgatc tggtacgaag cactgggcta cgacttccgc      2220
     atggcggtca acctgtcggc gcgccagttc caggccggcg atgtggtgcc gatgatcgag      2280
     cagacgctgg ccgactctgg cctgccgccc accgcgctcg aagtcgaaat taccgaaagc      2340
     ctgctgatgg gtggtgcgga tgaagtccgc cccatgttcg atgcgctcac cgcgcagggc      2400
     atccggatct ccatcgacga tttcggtacc ggatattcat cgctgtcgta tctgcagcgc      2460
     ttcccgatca gcaacgtgaa gatcgaccgc tcgttcatca ccggcattcc gcacgacccg      2520
     gattcggtgg cgctgaccga ggccatcgtc gccatggccc gcgccctggg catgacggtc      2580
     acagccgagg gcgtggaaga cgcagaccag gtggagttcc tcgccaaggc gggctgccag      2640
     gaaatccagg gttactacat cggtaagccg gtcacggccg aaggtttcga ccgtttgctg      2700
     cgggcgcacc tgtcggttgt ggatgccggc gtgcgcgccg cgctgggctg a               2751
//

If you have problems or comments...

PBIL Back to PBIL home page