(data stored in ACNUC7421 zone)

EMBL: CP001069.PE439

CP001069.PE439       Location/Qualifiers
FT   CDS_pept        501885..502388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4218"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05433 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29315"
FT                   /db_xref="GOA:B2UIB4"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB4"
FT                   /protein_id="ACD29315.1"
FT                   /translation="MVESIASIVSHTPAWVFVVFAVLIAIGVRQMQPRIVSRRRLIVLP
FT                   LVVAAYSLYGVSMASHGSPLALTMWLVAVVVAFLVTYMSPPNGAVSETARTVRVPGSWV
FT                   QMVVIVGLFAARYAYNVMLAIRPEVSHSGSFTALFSALFGFLGGLLLSRSVLLHVRTPR
FT                   LAAA"
     atggtcgaat cgatcgcctc catcgtctcg catacgcccg cctgggtgtt cgtcgtgttt        60
     gcggtgctga ttgccattgg ggtgcgtcag atgcagcccc gcatcgtgtc gcgccgccgc       120
     ctgatcgtgc tgccgctcgt ggtggccgcg tattcgcttt acggcgtgtc gatggcaagc       180
     catggcagcc cgcttgcgct cacgatgtgg ctggtcgcgg ttgtcgtggc gttcctggtg       240
     acgtatatgt cgccgcccaa cggcgccgtc tctgaaacgg cccgcactgt gcgtgtgccg       300
     ggcagctggg tgcagatggt cgtgatcgtg ggcctgttcg ccgcccgcta tgcctacaac       360
     gtgatgctgg cgattcgccc ggaagtctcg cactccggca gcttcacggc gctgttcagt       420
     gcgctgttcg gcttcctggg cgggctgctg ctctcgcgct cggtgctgct gcatgtgcgt       480
     acgccgcgcc tggcggcggc ttga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page