(data stored in SCRATCH zone)

EMBL: CP001069.PE440

CP001069.PE440       Location/Qualifiers
FT   CDS_pept        502447..503259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4219"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: molybdate transport repressor, ModE; PFAM:
FT                   regulatory protein LysR; TOBE domain protein; KEGG:
FT                   rso:RS05434 putative molybdenum-pterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29316"
FT                   /db_xref="GOA:B2UIB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB5"
FT                   /protein_id="ACD29316.1"
FT                   /translation="MLELDGTIWLRAGEDNWGGRGRIELLAAIGQTGSITAGAKAVGLS
FT                   YKAAWDAIDTMNNLAGEPLVVRTTGGKGGGGSVLTPRAQRLIESFRVLEAEHRRFVERL
FT                   DAAAQAASEDVHLLRRLMLRTSARNTLFGTVESVAPGAVNDVVTLRLPGGQAVAATITQ
FT                   ESTRVLGLAPGVQAVALIKAPAVMLMRGAGEWRVSAENQLPCVVTEIRDGAVQAEVRLR
FT                   LLDVSDPSAAETVLVAMLSRTAVQTLALAEGVEAVAVFEASSVILGLA"
     atgctggaac tcgatggcac catctggctg cgcgccggtg aagacaactg gggcgggcgt        60
     ggccggatcg aactgttggc tgccatcggg cagaccggct ccatcacggc aggcgccaaa       120
     gccgtgggcc tttcctacaa ggccgcctgg gacgccatcg acaccatgaa caacctggcc       180
     ggcgagccgt tggtggtgcg caccacgggc ggcaagggtg gtggcggcag tgtgctgacg       240
     ccgcgtgcgc aacggctgat cgagagcttt cgcgtgctgg aagccgagca ccgccgcttt       300
     gtcgagcgcc tggatgcggc cgcgcaggcc gccagtgaag acgtccacct gctgcgccgc       360
     ctcatgttgc gcacgagcgc gcgcaatacg ctgttcggca cggtcgaatc ggtcgcgccg       420
     ggcgccgtca acgatgtggt gacgctgcgc ctgcccggcg ggcaggctgt cgctgccacc       480
     atcacccagg agagcacgcg cgtgctgggg ctggcgccgg gtgtgcaggc cgtcgcgctc       540
     atcaaggcgc ctgccgtgat gctgatgcgc ggcgccggcg agtggcgcgt ctcggcagaa       600
     aaccaattgc cgtgcgtggt cacggaaatc cgcgatggtg cggtgcaggc cgaagtgcgg       660
     ctgcgcctgc tggatgtaag cgacccgtcg gcggcggaaa ccgtgctggt ggccatgctc       720
     tcgcgcacgg cggttcaaac gctggcgctg gctgaaggcg tggaagccgt ggcggtgttc       780
     gaggcgtcga gcgtgatcct gggattggcc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page