(data stored in ACNUC7421 zone)

EMBL: CP001069.PE443

CP001069.PE443       Location/Qualifiers
FT   CDS_pept        complement(504507..505193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4222"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RS05467 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29319"
FT                   /db_xref="GOA:B2UIB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB8"
FT                   /protein_id="ACD29319.1"
FT                   /translation="MSASIWTPLLLSLKVAGWATVLNLVLGVGAAYALARTRSRLREVI
FT                   DSVLTLPLVLPPTVLGYYLLVLLGRRGTIGGWLDSMGIQLVFTWQGAVIASTVVAFPLV
FT                   MKSARAAFEGVDHQLENAARVLGLPEAAVFFRVTLPLAARGIAAGVLLAFARALGEFGA
FT                   TLMIAGNLPGRTQTLSVAIYEAVQAGDDATANTLVLITSVTCIVVLVVASRLLQGRAPS
FT                   LQEQLA"
     atgtccgctt ccatctggac gcctctgctg ctctcactca aggtggcggg ctgggcgacc        60
     gtcctcaacc tcgtgctggg cgtgggcgcg gcctacgcgc tcgcacgcac gcgcagccgc       120
     ctgcgcgagg tcatcgattc ggtcttgacg ctgcccctgg tgctgccgcc gacggtgctc       180
     ggctattacc tgctggtgct gctgggccgg cgcggcacga tcggcgggtg gctcgacagc       240
     atgggcatcc agctcgtctt tacctggcag ggtgcggtga tcgcctccac cgtggtggcg       300
     tttccgctgg tcatgaagtc ggcacgcgcc gcctttgaag gcgtcgatca tcaactggaa       360
     aacgcggcgc gtgtgctggg cctgcccgaa gccgccgtgt tctttcgcgt cacgctgccg       420
     ctggctgcac gcggcattgc agccggtgtg ctgctggcct ttgcccgtgc cctgggcgaa       480
     tttggtgcca ccctcatgat tgccggcaac ctgcccggcc gcacgcagac gctctccgtg       540
     gccatctacg aagccgtgca ggccggcgac gacgccacgg ccaatacgct ggtgctgatc       600
     acctcggtca cctgcatcgt ggtgctggtc gtggccagcc gcctgctgca agggcgcgca       660
     ccgagcctgc aggagcagct ggcatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page