(data stored in ACNUC7421 zone)

EMBL: CP001069.PE445

CP001069.PE445       Location/Qualifiers
FT   CDS_pept        complement(507044..510250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4224"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RSp1113 probable transmembrane multidrug-efflux system
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29321"
FT                   /db_xref="GOA:B2UIC0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC0"
FT                   /protein_id="ACD29321.1"
FT                   /translation="MNFSKFFVDRPIFAGVLSTLILLIGIISIWRLPISEYPEVVPPSV
FT                   VVRAQFPGANPKVIAETVASPLEEQINGVENMLYMQSQANSDGNLTTTVTFKLGTDPDK
FT                   AQQLVQNRVSQALPRLPDVVQRLGVTTVKSSPDLTMVVHLLSPNDRYDMTYLRNYAVLN
FT                   VKDRLARISGVGQVQLFGSGDYSMRVWLDPNKVAERGLTANEVVKAIRDQNVQVAAGVI
FT                   GGSPSVPGTDLQLSVNAQGRLKTEQEFGDIILKSSPNGAVTYLRDVARIELAASEYGLR
FT                   SLLDNKQAVAIPIFQAPGSNALQISDDVRKTMAELKEDFPEGVDYRIVYDPTQFVRSSI
FT                   EAVTHTLLEAVALVVLVVILFLQTWRASIIPLLAVPVSIIGTFGLMLMFGFSINALSLF
FT                   GLVLAIGIVVDDAIVVVENVERNIAEGLSPREATYKAMREVSGPIIAIALTLIAVFVPL
FT                   AFMTGLTGQFYKQFALTISISTVISAFNSLTLSPALAALLLKSHDAPKDWLARAMDKGL
FT                   GWIFRPFNRVFGAASESYGRSTSRVIGRKAVMLGIYLALIGATALLFNKVPGGFVPMQD
FT                   KQYLVSFAQLPDGASLDRTEDVIRRMSDIALKHPGVESAVAFPGLSINGFTNSPSAGIV
FT                   FVTLKPFDERKTPNLSGGAIAGQLNQQYGAIKDAFIAVFPPPPVQGLGTVGGFKLQLED
FT                   RGSVGYEQLFAATQAFMAKARKTPELGPSFSSYQINVPQLNADLDRVKAKQLGVPVTDV
FT                   FDTMQVYLGSLYVNDFNRFGRTYQVKVQADAPFRAHAEDILQLKTRNTAGEMVPLSSLL
FT                   RVSQGFGPDMVVRYNGYTAADINGGPAPGFSSGQAQAAVERIAHETLPKGVRFEWTDLT
FT                   YQQILAGNSAVWIFPICVLLVFLVLAAQYESLTLPLAVILIVPMSLFAAMLGVWVSHGD
FT                   NNIFTQIGLVVLVGLACKNAILIVEFARELELQGRTIVEAAIEACRLRLRPILMTSIAF
FT                   IMGVVPLVVSTGAGAEMRHAMGVAVFAGMLGVTLFGLFLTPVFYVLLRTLAARRGQRSE
FT                   DAPDRDLDLDGTLPVPSTQH"
     atgaacttct ctaaattttt cgtggaccgc ccgatctttg cgggcgtgct ttccacgctg        60
     atcctgctga tcgggatcat ctcgatctgg cgattgccga tctcggagta tcccgaggtc       120
     gtgccgcctt cggtggtggt gcgcgcgcag ttcccgggcg ccaacccgaa ggtgattgcc       180
     gagaccgtcg cctcgccgct cgaagagcag atcaacggcg tcgagaacat gctctacatg       240
     cagtcgcaag ccaacagcga cggcaacctg accacgacgg tcaccttcaa gctgggcacc       300
     gacccggaca aggcacagca gctcgtgcag aaccgcgtgt cgcaggcgct gccgcgtctg       360
     cccgacgtgg tgcagcgcct gggcgtgacc accgtcaaga gcagccccga cctgacgatg       420
     gtggtgcact tgctgtcgcc caacgaccgc tacgacatga cgtacctgcg caactacgcc       480
     gtgctgaacg tcaaggaccg ccttgcacgg atcagcggcg tgggccaggt gcagctgttc       540
     ggctcgggtg actactcgat gcgcgtgtgg ctcgacccga acaaggtggc cgagcgcggc       600
     ctgacggcca acgaagtggt caaggccatc cgcgaccaga acgtgcaggt ggcagccggt       660
     gtgatcggcg gttcgccgtc ggtgccgggt acggacctgc aactgtccgt caacgcacag       720
     ggccgcttga agaccgagca ggagttcggc gacatcatcc tcaagagttc gcccaacggc       780
     gccgtcacct acctgcgtga cgtggcccgc atcgagctgg ctgcgtcgga atacggcctg       840
     cgttcgctgc tggacaacaa gcaggcggtg gccattccga tcttccaggc gccgggttcc       900
     aacgcgctgc agatttcgga tgacgtgcgc aagacgatgg ccgagctgaa ggaagacttt       960
     cccgaaggcg tcgactaccg catcgtctat gacccgacgc agttcgtccg ctcgagcatc      1020
     gaagccgtca cgcacacgct gctggaagcg gtggcgcttg tggtgctcgt ggtgatcctg      1080
     ttcctgcaga cgtggcgtgc gtcgatcatt ccgctgctgg cggtgccggt gtcgatcatc      1140
     ggtacgtttg gcctgatgct gatgttcggc ttctcgatca acgcgctgtc attgttcggg      1200
     ctggtgctgg cgatcgggat cgtggtggac gatgccatcg tggtggtgga aaacgtcgag      1260
     cggaacatcg ccgaagggtt atcgccacgc gaggccacgt acaaggccat gcgcgaagtg      1320
     agcggcccga tcatcgccat tgccctgacg ctgattgccg tgttcgtgcc gctggccttc      1380
     atgacgggcc tgaccggtca gttctacaag cagttcgcgc tgacgatctc gatctcgacc      1440
     gtcatctcgg ccttcaactc gctcacgctg tcgcccgcgc tggccgccct gctgctcaag      1500
     agccacgacg cgccgaagga ttggctggcg cgtgcaatgg acaagggcct gggctggatc      1560
     ttccgtccgt tcaaccgcgt gtttggtgcg gcgtcggaat cgtatggccg cagcacgtcg      1620
     cgcgtgatcg gccgcaaggc cgtgatgctg ggcatctacc tggcgttgat cggagcgacc      1680
     gcgctgctgt tcaacaaggt gccgggcggc ttcgtgccga tgcaggacaa gcagtacctg      1740
     gtgagcttcg cgcagttgcc ggacggtgcc tcgctggacc gcacggaaga cgtcatccgc      1800
     cgcatgtcgg acatcgccct caagcacccc ggcgtggaaa gcgccgtggc gttcccgggc      1860
     ctgtcgatca acggcttcac caacagcccg agcgcgggca tcgtgttcgt cacactcaag      1920
     ccgtttgacg agcgcaagac ccccaacctg tcgggcggtg ccatcgcggg gcaactgaac      1980
     cagcagtacg gtgcgatcaa ggacgcgttc atcgctgtgt tcccgccgcc gccggtgcaa      2040
     ggcctcggca cggtgggtgg cttcaagctg caactggaag accgcggctc ggtcggctac      2100
     gaacagctct ttgccgccac gcaggccttc atggcgaagg cacgcaagac gcctgagctg      2160
     ggcccgtcgt tctcgagtta ccagatcaac gtgccgcagt tgaatgcaga ccttgaccgc      2220
     gtgaaggcca agcagcttgg cgtgccggtg acggatgtgt tcgacaccat gcaggtgtat      2280
     ttgggctcgc tgtacgtgaa cgacttcaac cgcttcggcc gcacgtatca ggtgaaggtg      2340
     caggcagacg cgccgttccg cgcgcatgca gaagacatcc tgcaattgaa gacgcgcaac      2400
     accgcgggcg agatggtgcc gctgtcttcg ctgctgcgcg tgtcgcaagg cttcgggcca      2460
     gacatggtcg tgcgctacaa cggctacacc gctgccgata tcaacggtgg cccggccccg      2520
     ggcttctcgt cgggccaggc gcaggcggcc gtggaacgca tcgcgcatga aacgctgccc      2580
     aagggcgtgc gcttcgagtg gacggatctg acgtatcagc agatcctggc cggcaactcg      2640
     gccgtgtgga tcttcccgat ctgcgtgctg ctggtgttcc tggtgctcgc cgcgcagtac      2700
     gaaagcctga cgctgccgct ggccgtgatc ctgatcgtgc cgatgagcct gtttgccgcc      2760
     atgctgggcg tgtgggtctc gcatggagac aacaacatct tcacgcagat cggtctggtg      2820
     gtgctggtgg ggctggcgtg caagaacgcc atcctgatcg tggagtttgc gcgcgagctg      2880
     gagctgcaag gacgcaccat cgtggaagcc gccatcgagg cttgccgcct gcgtctgcgc      2940
     ccgatcctga tgacgtcgat cgctttcatc atgggcgtgg tgcccctggt ggtatcgacc      3000
     ggcgccggtg cggaaatgcg tcatgccatg ggcgtggccg tgttcgcggg gatgttgggt      3060
     gtgacgctgt tcggcctgtt cctcacgccg gtgttctacg tgctgctgcg cacgctggcg      3120
     gcacgccgcg gccagcgctc ggaagacgcc cccgatcgtg atctggacct ggatggcacg      3180
     ctgcctgtgc cgtcgaccca gcactaa                                          3207
//

If you have problems or comments...

PBIL Back to PBIL home page