(data stored in ACNUC7421 zone)

EMBL: CP001069.PE446

CP001069.PE446       Location/Qualifiers
FT   CDS_pept        complement(510280..511590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4225"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RSp1112 probable transmembrane multidrug efflux system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29322"
FT                   /db_xref="GOA:B2UIC1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC1"
FT                   /protein_id="ACD29322.1"
FT                   /translation="MSLSKRTLAISVAAVLGVAAVGTYGLVSSAGASQQPAAAPAATPV
FT                   DVAPVLAKNVSEWDEFSGRIEAVQRVEVRPLVSGTVTAVHFKDGSIVKKGDALFTIDPR
FT                   PYAAEVARTQAALTAAKSRVAYTTSELDRAQKLVADNAIARREFEEKENAAREAQANLQ
FT                   GAAAALEAARLNLEYTHIVAPVAGRVSRAEITVGNVVSAGGAAPVLTTLVSVSPMYVAF
FT                   DADEQSYLRYSAKAAQGAKTPVYIGLANEDGYTREGAIQSVDNRLDVRSGTIRVRATLD
FT                   NADGRLTPGLYARVRMSTGAPHDAILITDKAIGTDQDKKFVLVVDAANKTSYRPVVLGA
FT                   SIDGLRVVKSGLKAGERIVVNGIQRVRPGDAVAPNTVTMDSLVTKRVVLPGAQPEAPAA
FT                   PAEAKADTTTAPAAKAEAKAANAKTAATAQRLPADRA"
     atgagcctgt ccaaacgcac actcgccatt tcggttgccg ccgtgctcgg cgttgcagct        60
     gtgggcacct acggtctggt ctccagcgcc ggcgcatcgc aacagccggc agccgccccc       120
     gccgccacgc cggtggatgt ggcgccggtg ctggccaaga acgtttccga atgggatgaa       180
     ttttccggcc gaatcgaagc cgttcaacgc gtagaagtcc gcccactggt gagcggcacc       240
     gtcaccgccg tccacttcaa ggacggcagc atcgtcaaga agggcgacgc gctgttcacc       300
     atcgacccgc gcccctacgc ggcggaagtg gcccgcacgc aagccgcact gaccgccgcc       360
     aaatcgcgcg tggcctacac cacgtcggag ctggaccgcg cgcagaagct ggtggccgac       420
     aacgccatcg cgcggcgcga gttcgaagag aaggaaaacg ccgcccgcga ggcccaagcc       480
     aacctgcaag gcgccgccgc cgcgctggaa gccgccaggc tgaacctgga gtacacgcac       540
     atcgtggcgc cggtcgcggg ccgcgtgtcg cgcgcagaaa tcaccgtcgg caacgtcgtc       600
     tcggcggggg gtgctgcgcc ggtattgacg acgctggtgt cggtctcgcc gatgtacgtg       660
     gcgttcgatg cggatgaaca aagctacctg cgctactccg ccaaggccgc ccagggcgcc       720
     aagacgccgg tctacatcgg gctggccaat gaagacggct acacgcgcga aggcgccatc       780
     cagtccgtcg acaaccggct cgatgtgcgc tcgggcacga tccgcgtgcg ggccacgctg       840
     gacaacgccg acggccgcct cacgccgggc ctctacgccc gcgtgcgcat gagcaccggc       900
     gcaccgcacg acgccatcct catcaccgac aaggccatcg gtacggacca ggacaagaag       960
     ttcgtcctgg tggtggatgc ggccaacaag acgagctatc ggccggtggt gctgggcgcc      1020
     tccattgacg gcctgcgcgt ggtgaagtcg ggcctgaagg cgggtgaacg gatcgtcgtc      1080
     aatggcatcc agcgcgtgcg ccccggcgac gccgtggcac ccaacacggt gaccatggat      1140
     agcctggtca ccaagcgcgt ggtgctgccc ggtgcacaac ccgaagcgcc cgcagcaccg      1200
     gccgaagcca aagccgacac aacgactgca cctgctgcca aggccgaggc caaggccgcc      1260
     aacgccaaga ccgccgctac cgcgcaacgc ctgccggccg accgcgcttg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page