(data stored in ACNUC7421 zone)

EMBL: CP001069.PE448

CP001069.PE448       Location/Qualifiers
FT   CDS_pept        513138..514082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4227"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS02618 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29324"
FT                   /db_xref="GOA:B2UIC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC3"
FT                   /protein_id="ACD29324.1"
FT                   /translation="MDRLQAMQVFTRVVEASSFTKAADSLQLPRATVTNLVQSLEAHLG
FT                   VRLLHRTTRRVNVTADGAAYYERCVRLLGDLEETEAAFSQSSSGARGTLRIDVPASIGK
FT                   RLLVPRIRDFHEAYPDLQLEIGMSDRTVDLVQEGVDCAVRGGELQDSSLVARRIGQLSM
FT                   VNCASPEYLARCGTPKTLEDLQDHTAVNYFSARNGRRMDWDFVIDGQKQIHKVRSMVSV
FT                   NDAESAVACGLHGLGLLQTSRFLVYEHLMSGALVEVLPDHISEAVPVSVVYPHNRHLSP
FT                   KVRVFVDWVATLFADHPCLQLKENPRLHIVSAA"
     atggatcgct tgcaggccat gcaggttttc acgcgcgtcg tggaagccag cagtttcacc        60
     aaggctgccg acagccttca gttaccccgc gccacggtga cgaacctggt gcaaagcctt       120
     gaggcacacc ttggcgtgcg cctgctgcac cggaccacac gccgtgtgaa tgtcaccgcc       180
     gatggcgctg cgtattacga gcgctgcgta cgcttgctcg gcgatcttga agagaccgag       240
     gctgcgttct cgcaaagctc gtcgggcgca cgcggcacct tgcgcatcga cgtgcctgcg       300
     tcgattggca aacggttgct tgtgccgcgc attcgcgatt ttcacgaggc gtaccccgat       360
     cttcagttgg agatcggcat gagcgatcgc accgtcgacc tcgtgcagga gggcgtggat       420
     tgcgccgtgc gcggtggcga gttgcaggac tccagccttg tcgcgcgccg catcggccag       480
     ctgtcgatgg tcaattgcgc gtcgcccgaa tatctggccc gctgcggtac gcccaagacg       540
     ttggaagacc tgcaggacca cacggcggtg aattacttct ctgcgcgcaa cggccgccgc       600
     atggattggg atttcgtaat cgacgggcag aagcagattc acaaggtgcg cagcatggtg       660
     tccgtcaacg atgccgaatc ggcggtggcg tgtggcctgc atggcctggg gctgctacag       720
     acttcacgct tcctggtgta tgagcacctg atgtcgggcg cgctggtgga agtgctgccg       780
     gatcatattt ccgaagcggt gcccgtatcg gtggtgtatc cgcacaaccg gcatctgtcg       840
     cccaaggtgc gggtgtttgt ggactgggtt gcgacgctgt ttgccgacca cccgtgcctg       900
     cagctcaagg aaaatccgcg actgcacatt gttagcgccg cctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page