(data stored in SCRATCH zone)

EMBL: CP001069.PE451

CP001069.PE451       Location/Qualifiers
FT   CDS_pept        complement(515363..516793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4230"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: rso:RSp1105 probable
FT                   alpha,alpha-trehalose-phosphate synthase protein; TIGRFAM:
FT                   alpha,alpha-trehalose-phosphate synthase [UDP-forming];
FT                   PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29327"
FT                   /db_xref="GOA:B2UIC6"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC6"
FT                   /protein_id="ACD29327.1"
FT                   /translation="MSRLIVVSNRVAPVAEGQGTAGGLAVGVFDALRETGGIWFGWSGE
FT                   SAATVSHEPTIVTKGNITYATVGLNRKDYDQYYRGFANATLWPIFHYRVDLSRYERQEY
FT                   HGYRRVNAQFAHQLKALVQPDDILWVHDYHLIPFAAECRALGLTNRIGFFLHIPFPSPE
FT                   ILTTIPPHEDLMRALCAYDLVGFQTETDRVAFYDYIEREARGYIEQKEQNGPVHAYGHT
FT                   LRAEVYPIGVHPDEIAQQAKASLARRNPFMRHAGARGERIAPQGQGQGQPPTKLIMSVD
FT                   RLDYSKGLPERFRAFEQLLDDFPDHRRHVTFIQIAPTSRQDVQSYQQIRQRLEAESGRI
FT                   NGKHSELDWTPIRYINKQYERRVLMALFRSSQIGYVTPLRDGMNLVAKEYVAAQDPENP
FT                   GVLVLSRFAGAARELDAALIVNPYDTRGMAEALNRALTMPLEERKARYAHMMDRLRSAN
FT                   LTIWRERFVTDLRGAPSR"
     atgagccgac tcattgtggt ttccaaccgc gttgcgcccg ttgccgaagg ccagggaacg        60
     gccggcggcc tggccgtggg tgtgttcgat gcgctgcgcg aaaccggcgg catctggttt       120
     ggctggagcg gcgaaagcgc agccactgtt tcacacgagc cgaccatcgt caccaagggc       180
     aatatcacct atgccaccgt cggcctgaac cgcaaggact acgaccagta ctaccgcggt       240
     tttgccaacg cgacgctgtg gccaatcttc cattaccgcg tggatctgtc gcgctacgag       300
     cgccaggagt accacggtta ccggcgcgtc aatgcgcagt ttgcgcatca gctcaaggcg       360
     ctggtgcaac ccgacgacat cctttgggtg cacgactatc acctgatccc gtttgccgca       420
     gagtgccgcg cgctggggct gaccaaccgc atcgggttct tcctgcatat tccgtttccg       480
     tcgccggaaa tcctgacgac gattccgccg catgaagacc tcatgcgcgc gctgtgtgcg       540
     tacgacctgg tcggtttcca gacagagacc gaccgcgtgg ccttctacga ctacatcgag       600
     cgcgaggcgc gcggctacat cgagcagaaa gagcagaacg gcccggtaca cgcctatggc       660
     cacacgctgc gcgcggaggt ctacccgatc ggcgtgcatc cggacgagat cgcgcagcaa       720
     gccaaggcgt cgctggcacg gcgcaatccg ttcatgcggc atgcgggcgc gcgcggcgag       780
     cgcattgcgc cgcaggggca aggccaaggc cagccgccca cgaaactcat catgagcgtc       840
     gatcggctcg actattccaa aggcctgccc gagcgcttcc gcgcgttcga gcaattgctg       900
     gacgattttc cggaccatcg ccggcacgtg accttcatcc agattgcgcc cacgtcgcgc       960
     caggacgtgc agagctatca gcagatccgg cagcggctgg aggctgaatc gggccgcatc      1020
     aacggcaagc attcggaact ggactggacg cccatccgct acatcaacaa gcagtacgaa      1080
     cggcgcgtgc tgatggcgct tttccgcagc tcgcagatcg gttatgtcac gcctctgcgt      1140
     gacggcatga acctcgtcgc caaggaatac gtggccgcac aagacccgga aaacccgggc      1200
     gtgctcgtgc tgtcgcgctt tgccggcgcg gcgcgcgagt tggatgccgc actgatcgtc      1260
     aacccgtatg acacgcgcgg catggccgag gcactgaacc gcgcgttgac gatgccgctc      1320
     gaagaacgca aggcgcgcta tgcccacatg atggatcggc tgcggtcggc caacctcacc      1380
     atctggcgcg agcggttcgt gacagacctg cgcggcgcgc cgtcgcgata g               1431
//

If you have problems or comments...

PBIL Back to PBIL home page