(data stored in SCRATCH zone)

EMBL: CP001069.PE452

CP001069.PE452       Location/Qualifiers
FT   CDS_pept        complement(516790..517590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4231"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: rso:RSp1104 probable trehalose-phosphatase
FT                   protein; TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29328"
FT                   /db_xref="GOA:B2UIC7"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC7"
FT                   /protein_id="ACD29328.1"
FT                   /translation="MSKNVSPQSSANAAPLPSLDLGRTAFLLDFDGTLVDIAPQPEAVH
FT                   VSAPLRETLAALHAASGGALAIISGRTVHDVESRLSLPGLVIAGVHGAERRYADGGFVR
FT                   LNADADALAQLERELRAELTQLSTQFSGVVLESKGIAFALHYRHAPEAENAVLTVADRL
FT                   ARRYADHVRLQAGKMVAELKPRGASKGDVVHTLMTEPPFMGRTALFAGDDLTDESAFDA
FT                   VNALEGWSIKVGTGPSQARWRVQDAAALRAWLATLTAPSKRGAA"
     ttgtccaaga acgtctctcc ccagtcttct gccaacgcgg cgcccctgcc ctcgctcgac        60
     ctgggccgaa cggccttcct gctcgacttt gacggcaccc tcgtcgatat cgcgccgcaa       120
     cccgaagcgg tgcatgtttc tgcgccgctg cgcgaaacgc tggccgcgct gcatgccgcc       180
     agcgggggcg cgttggcgat cattagcggg cgcacggtgc atgacgtgga gtcgcgcctg       240
     tctctgcccg gcctcgtcat cgccggtgtg cacggcgccg aacgccgcta tgcagacggc       300
     ggcttcgtcc gcctgaacgc tgacgcagat gcactcgcgc aactggagcg cgagttgcgc       360
     gcagaactca cgcagttgtc gacgcagttt tcgggcgtgg tgctggaaag caagggaatt       420
     gcgtttgccc tgcactaccg ccacgcgcct gaagccgaga acgccgtact gacggtagcg       480
     gaccgcctcg cgcgccgcta tgccgaccac gtgcgcctgc aggccggcaa gatggtcgcc       540
     gaactcaagc cgcgcggcgc cagcaagggc gacgtagtgc acacgctgat gaccgaaccg       600
     cccttcatgg gccgcacggc gctgtttgcc ggcgacgacc tgaccgatga aagcgccttc       660
     gatgccgtca atgcgctgga gggctggtcg atcaaggtgg ggacgggccc aagccaggcg       720
     cgttggcgcg tgcaagacgc ggcggcattg cgggcctggc tggcaacgct cacggccccg       780
     tccaagcgag gtgccgcatg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page