(data stored in ACNUC7421 zone)

EMBL: CP001069.PE454

CP001069.PE454       Location/Qualifiers
FT   CDS_pept        complement(519911..520117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS02609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29330"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC9"
FT                   /protein_id="ACD29330.1"
FT                   /translation="MYPIADPIVKKTDLEKLKGLKIANNLKRNSQRTGKPGQGTGKAIP
FT                   QNKLLKALLGKPAEDDAKKSEKS"
     atgtatccca ttgcggaccc catcgtgaag aaaaccgacc tcgaaaaact caagggcctg        60
     aaaatcgcca acaacctcaa gcgcaacagc cagcgcaccg gcaagcccgg ccagggcacc       120
     ggcaaggcga ttccccagaa caagctgctg aaagcgctgc tcggcaagcc agctgaagac       180
     gacgcgaaaa agtcggaaaa atcctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page