(data stored in SCRATCH zone)

EMBL: CP001069.PE456

CP001069.PE456       Location/Qualifiers
FT   CDS_pept        521352..522377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4235"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain; KEGG:
FT                   rso:RSp1101 probable UDP-glucose 4-epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29332"
FT                   /db_xref="GOA:B2UID1"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID1"
FT                   /protein_id="ACD29332.1"
FT                   /translation="MTETILLTGATGYIASHTWVELLDAGYQVIGLDNLCNSSSTVLSR
FT                   IEQITAKTPKFVQGDVRDRRLLDDLFASSRISAVIHFAALKSVGESVQKPLAYYDNNMG
FT                   GLVTLCAAMAHANVRQLVFSSSATVYGNPHTVPITESFPLSATNPYGQTKVMGEQVLRD
FT                   LEISNAAWQIAYLRYFNPVGAHHSGLIGEDPRGIPNNLMPYVAQVAVGKREKLSIYGGD
FT                   WPTPDGTGVRDYIHVVDLARGHLAALDTLRRDGRGFTVNLGTGRGYSVLEVVEAYKRAS
FT                   GKPVPYQIVDRRPGDIAACYADPALAASLLGWRAQYGIERMCEDSWRWQSMNPDGFQTR
FT                   G"
     atgacagaaa cgattctgct gaccggcgct accggctaca tcgcctcgca cacctgggtt        60
     gaattgctgg atgcgggcta ccaggtgatc ggactcgaca acctctgcaa cagcagctcg       120
     accgtgctct cccgcatcga gcagatcacc gccaagacgc ctaagttcgt gcagggcgac       180
     gtgcgtgacc gccgcctgct agatgacctg tttgccagtt cgcgcatctc agctgtcatc       240
     cactttgcgg cgctcaagtc ggtgggcgaa tcggtgcaga agccgctggc ctactacgac       300
     aacaacatgg gcgggctggt cacgctatgc gcggccatgg cgcatgcgaa tgtgcgccag       360
     ctcgttttca gctcgtcggc aacggtgtat ggcaatccgc acaccgtgcc gatcaccgaa       420
     tcgtttccgc tgtcggccac caacccgtat ggccagacca aggtgatggg cgaacaggtg       480
     ctgcgcgatc tggagatttc caatgcggcg tggcaaatcg cctacctgcg ctatttcaat       540
     ccggtgggcg cgcaccacag cggcctgatc ggcgaagacc cgcgcggcat ccccaacaat       600
     ctgatgccgt atgtagcgca ggtggcggtg ggcaagcgcg agaagctttc catttacggc       660
     ggtgactggc caacgcctga cggcaccggc gtgcgcgact acatccacgt ggtggacctt       720
     gcgcgcgggc accttgcggc gctcgacacg ctgcgtcgcg atggccgcgg ctttacggtc       780
     aacctcggca cgggccgcgg gtattcggtt ctggaagtgg tggaggccta caagcgcgcc       840
     agcggcaagc cggttccgta ccagatcgtg gatcgccgcc ccggcgatat tgcagcgtgc       900
     tatgccgatc cggcactggc ggcctcgctg ctggggtggc gcgcgcaata cggcatcgag       960
     cgcatgtgtg aagactcgtg gcgttggcaa agcatgaatc cggacggctt tcaaacccgt      1020
     ggctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page