(data stored in ACNUC7421 zone)

EMBL: CP001069.PE458

CP001069.PE458       Location/Qualifiers
FT   CDS_pept        524024..525565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4237"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: rso:RS02605 putative methyl-accepting
FT                   chemotaxis transducer transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4237"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29334"
FT                   /db_xref="GOA:B2UID3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID3"
FT                   /protein_id="ACD29334.1"
FT                   /translation="MNRLTLRQKLWLPLVLSWLCLLLITLWSTWETRTLRLEERQRDLQ
FT                   NISESVFSIIKDYGQMAQDGKLAADEARAQALARIKMIRYGKDGYFSINQTNSVMVMHP
FT                   IKAEMNGKDMSGFTDPAGNHLFEEISRVGKSGGGFVDYLWPKPGAEAPQPKKSYVLYYQ
FT                   PWDWCLVTGTYMDDIETAFHASLIKALGLLFGVGLLMTVVVVAVTRSLQRQLGGEPAYA
FT                   ARIAGRIAAGDLAVPVETRSGDRDSMLYAMAQMQRELTGTIGNIKSSADSIASATKQIA
FT                   AGNADLSQRTEQQASSLEETASSMEELTSIVKQNADNARQASTLAVNASDIAVKGGEVV
FT                   GRVVETMSGINESSKKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RSLAQRSASAAKEIKDLIGDSVGRVQNGSALVEEAGVVIQDVVTAVKRVTDIMGEISAA
FT                   SDEQSSGIEQVNQAVNQMDEVTQQNAALVEQAAAAALSLEEQAQLLRTAVGRFQV"
     atgaatcgac tcacgcttcg tcagaagctg tggctgccac ttgtcctgag ttggctttgt        60
     ctgttgttga tcacattgtg gagcacttgg gagacccgca ccctgcgcct ggaagaacgc       120
     cagcgcgact tgcagaacat cagtgaatcc gtattcagca tcatcaaaga ctacggacag       180
     atggcgcaag acggtaagct cgccgccgac gaggcccgcg cccaggccct cgcgcgcatc       240
     aagatgatcc gctacggcaa ggatggctac ttcagcatca accagaccaa ctcggtgatg       300
     gtgatgcatc cgatcaaagc cgaaatgaac ggcaaggaca tgtcgggttt taccgacccg       360
     gcagggaatc atctgttcga ggaaatctct cgcgtgggca agagcggcgg cggctttgtc       420
     gattacctat ggcccaagcc cggcgcggaa gcgccgcagc cgaagaagag ctacgtgctg       480
     tattaccagc cttgggactg gtgcctcgtc acgggcacgt atatggacga catcgagacc       540
     gcattccacg cgtcgctaat caaggcgctg gggctgctgt ttggtgtcgg cttgctgatg       600
     actgtggtgg tcgtggccgt tacgcgcagc ctgcagcgcc agttgggtgg cgagcccgct       660
     tatgctgccc gcattgccgg ccgcatcgcc gcgggtgatc tggctgtgcc ggttgaaacc       720
     cgctcggggg atcgcgacag catgctctac gccatggcgc agatgcagcg tgagctgacg       780
     ggcacgatcg gcaacatcaa gagctcggcg gattccattg ccagcgccac caagcagatc       840
     gctgccggca atgccgacct gtcgcagcgt acggagcagc aggcctcgtc gctggaagaa       900
     acggcgtcga gcatggagga actgacgagc atcgtgaagc agaacgccga caatgcgcgt       960
     caggcaagca cactggccgt caatgcgtcg gatattgcgg tcaagggcgg agaggtggtc      1020
     gggcgcgtgg tcgagacaat gtccggcatc aacgaaagca gcaagaagat tgccgacatc      1080
     atcggggtga tcgagggcat cgctttccaa accaacatcc tggcgctgaa cgctgccgtg      1140
     gaggccgccc gcgcgggcga gcagggccga ggctttgccg tggtggcggg cgaagtgcgc      1200
     agcctggcgc agcgctcggc gagcgctgcc aaggaaatca aggacctgat cggcgattcg      1260
     gtgggccggg tgcagaacgg ctcggcgctg gtggaagagg ctggcgtggt gatccaggac      1320
     gtggtgactg ccgtgaagcg cgtaacggac atcatgggcg agatttctgc ggcgtccgac      1380
     gagcagagtt ccggcatcga gcaggtcaac caggctgtga accagatgga cgaagtgacg      1440
     cagcagaacg ctgcgctcgt ggagcaggcg gcggccgctg cgctgtcgct ggaagagcag      1500
     gcgcaattgc tgcgtacggc tgtggggcgc ttccaggtat aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page