(data stored in ACNUC7421 zone)

EMBL: CP001069.PE459

CP001069.PE459       Location/Qualifiers
FT   CDS_pept        complement(525686..525994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4238"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: rso:RS02604 putative HNS-like
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29335"
FT                   /db_xref="GOA:B2UID4"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID4"
FT                   /protein_id="ACD29335.1"
FT                   /translation="MPTYKEIVQKISELQRQADELRANEQATVIAEIKHKIVEYGLTAE
FT                   DLGFGAKGAVASKKAGRKVPVRYRDNNGNTWTGRGKRPGWLVKELSSGRKMEDFLVA"
     atgccgactt acaaggaaat cgttcagaag atctctgaac tgcagcgcca agccgatgaa        60
     cttcgggcaa atgaacaagc gacggtgatc gctgaaatca agcacaagat cgtggaatac       120
     ggcctgaccg ccgaagacct cggttttggc gccaagggtg ccgtggcctc gaagaaggct       180
     ggccgtaagg tgccggtgcg ttaccgcgac aacaacggca atacctggac gggccgtggc       240
     aagcgcccgg gctggctggt aaaggagctg tcgtcgggcc ggaagatgga ggattttctg       300
     gtcgcctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page