(data stored in ACNUC7421 zone)

EMBL: CP001069.PE468

CP001069.PE468       Location/Qualifiers
FT   CDS_pept        537152..538075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4247"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="TIGRFAM: Flp pilus assembly protein CpaB; PFAM: SAF
FT                   domain protein; KEGG: rso:RS02596 probable signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29344"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE3"
FT                   /protein_id="ACD29344.1"
FT                   /translation="MTSKHLQIFAAALLLLAAILGAVAWKSAHRPPAPVAEQKDGKAVY
FT                   PVVVTTKPLEAGKPITADQVAIEQLPINPAEAFSDVTKVVGREPILPVGVGVPLIASQL
FT                   SSGLAQQVEAGQRAVAINVDEVVGVGNRVMPGDYVDVFLVMRKDGQEIEDSQARLLLPH
FT                   LRVLAFGPLAINEGPQKQPENSGVTRKVDQAKTAVLAVPVEAVSQLAMAHQSGRLLLAL
FT                   RNPGDDAEPTVKPQDAALLAAANRNPMDVAQAGVSMASLTGSARRLVVVPPPLPAIAAA
FT                   RTTVRSSTASTGVEIIRAGKREEQHD"
     atgaccagca aacaccttca gatcttcgcc gccgcgctat tgctgctcgc cgccattctt        60
     ggcgccgtgg catggaagtc ggcgcatcgc ccgccggcgc ccgtggccga gcagaaagat       120
     ggcaaagcgg tctatcccgt ggtcgtgacc acgaaaccgc tggaggcggg caagcccatc       180
     accgcagacc aggtggccat cgagcaactg cccatcaatc cggccgaagc gttttccgac       240
     gtcacgaagg tcgtcgggcg tgaacccatt ctgccggtcg gcgttggtgt gccgctgatt       300
     gcgtcgcaac tttcctccgg attggcgcag caggtcgagg ccggtcagcg cgcggttgcc       360
     atcaacgtgg acgaggtggt cggcgtgggc aatcgcgtta tgccgggcga ttacgtcgat       420
     gtgtttctcg tgatgcgtaa ggacggtcag gagatcgaag acagccaggc gcgcctgctg       480
     ctgccgcacc tgcgggtcct ggcgtttggc ccgctggcca tcaatgaagg gccgcagaag       540
     cagcccgaga acagcggggt cacgcgcaag gtcgatcagg ccaagacggc cgtgctggcc       600
     gtgccggtgg aggctgtcag ccagctggcg atggcacacc agagcggtcg tctgctgctg       660
     gcgctgcgca acccagggga cgacgccgaa ccgaccgtca aaccgcagga tgccgcattg       720
     ctggcggccg ccaaccgcaa cccgatggac gtcgcacaag ccggcgtgtc gatggccagc       780
     ctgacgggct cggcgcgcag gctggtcgtt gtgccgccgc cgctgccggc cattgccgcg       840
     gcccgcacga cggtgcgcag cagtaccgcc agcactggtg tcgagatcat ccgcgcagga       900
     aaacgtgagg agcaacatga ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page