(data stored in ACNUC7421 zone)

EMBL: CP001069.PE470

CP001069.PE470       Location/Qualifiers
FT   CDS_pept        539442..540785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4249"
FT                   /product="putative pilus assembly protein"
FT                   /note="KEGG: rso:RSp1086 probable pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29346"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE5"
FT                   /protein_id="ACD29346.1"
FT                   /translation="MDYFLLHGGARGGKQGDAQSAGVHRWLAAAIRELGVLVAETTGHD
FT                   AFIEQIGAVNPEVVFVRFASSPTLIDVPDQDQKLGEGADAINEAMQLVAQLARLFPGLP
FT                   LVAVGSAADGRAMLAALRAGVKDFVDVDGAPAEAVRVVRRLLADRASAEPTRRGRVLAV
FT                   LGARPGVGATTLATNLATLVRRTSASDVMLLDLGQPLRDGALYLNVQANFHFVEAVRNL
FT                   RRFDQVFVQTALSRHPNGLAVLPLPISLAEMRDVSFSEALGLLNRLRTFFDLQVVDLGG
FT                   FGNIDFIAQIIKAADDVMLVTEQSVGAIVSAAELMQELKKREIDRDHLHLTISKFDARL
FT                   SLDAAQIAERLEIPSVLTVPNRREALVIASNQGAMLAETHPTDAYVRALAQIAQTLGYA
FT                   QQSERASGLSNWVSGVSARLGGRFGGRSKRKSADANELDIGTTERNAT"
     atggactatt tccttctgca cggcggcgca cgtggcggta agcaaggcga cgcacagtcg        60
     gcaggcgtac accgctggct ggccgcggca attcgcgagt tgggcgtgct ggtggccgaa       120
     accactggcc acgacgcgtt catcgagcag attggcgcag tgaaccccga ggtggtgttc       180
     gtgcgctttg cctcgtctcc cacactgatc gacgtgccag atcaggacca gaagctgggc       240
     gagggcgccg acgcgatcaa cgaggcgatg caactggtcg cgcaacttgc gcgtctgttt       300
     ccgggcttgc cgctggtggc ggtgggctcc gctgccgatg gccgcgcgat gctggctgcc       360
     ttgcgcgcag gggtaaagga tttcgttgac gtggacggcg cgccggccga ggctgtgcgc       420
     gtcgtgcgtc gactgctggc ggaccgcgca tcggctgagc cgacccgccg tggccgcgtg       480
     ctggccgtgt tgggcgcgcg ccccggcgtg ggcgccacca cgttggccac caatctggcc       540
     acgctggtgc gccgcacgtc ggccagcgat gtgatgctgc tcgaccttgg ccagccgctg       600
     cgtgatggcg ccctatacct taacgtgcaa gccaacttcc actttgtcga agccgtgcgc       660
     aacctgcgcc gcttcgacca ggtgtttgtg cagaccgcgc tgtcgcgtca tccgaacggg       720
     cttgcggtcc tgccgttgcc gatctcgcta gccgagatgc gcgacgtttc gttctccgaa       780
     gcgctgggtc tgctcaaccg cttgcgcacg ttcttcgacc tgcaggtcgt tgacctgggt       840
     ggctttggca acatcgactt catcgcacag atcatcaagg ccgccgacga tgtgatgctg       900
     gtgaccgagc aaagcgtggg cgccatcgtg tcggcggctg aactgatgca ggaactcaag       960
     aagcgcgaga ttgaccgtga ccacctgcac ctgaccattt cgaagttcga cgcacgcctg      1020
     tcgctggacg cagcgcagat cgccgagcgg ctggagattc cttcggtgct gacggtaccg      1080
     aatcgccgtg aagccctggt cattgcttcc aaccagggcg cgatgctcgc ggaaacgcac      1140
     cccaccgatg cctatgtccg cgcgcttgcg cagattgccc agacactcgg ctatgcccag      1200
     cagagcgagc gcgcgtctgg cttgtcgaac tgggtgtctg gcgtgagtgc tcgactgggt      1260
     gggcgctttg gcggacgctc caaacgcaag tcggcagacg ccaatgaact ggatatcggt      1320
     actaccgaac ggaacgcgac atga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page