(data stored in ACNUC7421 zone)

EMBL: CP001069.PE475

CP001069.PE475       Location/Qualifiers
FT   CDS_pept        544977..545306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4254"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS02588 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29351"
FT                   /db_xref="InterPro:IPR022053"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF0"
FT                   /protein_id="ACD29351.1"
FT                   /translation="MIPRILMAAGMAVWLMSNPAGAQGFSGGNPQNATQAAPNVGSNMG
FT                   DATRALLKAQRDGTYAGEFVPLRGEQAALAYQRYLDSFSRPMPGLSQTAPSAKSTSSSQ
FT                   ATTAR"
     atgatccccc gcattctgat ggctgccggt atggcggtat ggctgatgag caacccggct        60
     ggcgcgcaag gcttttcggg cggcaatccg cagaacgcta cgcaagccgc gcccaacgtg       120
     ggtagcaaca tgggcgatgc cactcgcgcc ttgctcaagg cgcaacgcga tgggacgtat       180
     gcgggcgagt tcgtcccgtt gcgcggggag caggccgcgc tggcgtatca gcgctacctt       240
     gattcgttca gtcgaccgat gcctggcctc tcgcagacgg ctccaagtgc gaagtcgaca       300
     agctcgagtc aagccactac cgcacgttga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page