(data stored in ACNUC7421 zone)

EMBL: CP001069.PE477

CP001069.PE477       Location/Qualifiers
FT   CDS_pept        547072..548487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4256"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   rso:RS02586 probable sigma-54 interacting transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29353"
FT                   /db_xref="GOA:B2UIF2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF2"
FT                   /protein_id="ACD29353.1"
FT                   /translation="MKTDRWAYETLEIFVWEGRHDIADRVARFMAPFGAEVIRAGGIDF
FT                   QPAEPRLKPAVAVISASVVESGGFTVLDWQAAQGMPVIWVASDAQHDSSRFPPEYTHVL
FT                   GPDFGATELRAQISKVLPSMSSAQAQAQDQSDLVAASPAMHGLLEQVDTFADCDSNVML
FT                   YGETGAGKERIARLLHDKNSVYGKGPFVAVNCGAIPDGLFESQFFGHAKGAFTGAMYAH
FT                   RGYFEQANGGTLFLDELGDLPLYQQVKLLRVLEDSECTRLGSTVPVKLDFRLVAATNKN
FT                   LREMVATGKFRADLYFRLAVIELRIPSLEQRGADDKIALLLSFLRHLLGDKTFDAMPPV
FT                   PEWVRASVGRAYFAGNVRELRNLAERIGITLRQFGRWDEARILPLFAGLQRDAFEREAG
FT                   NGGNGGYGDRGGGGSGGNGGEEERRRILAALDANNWRRQDTAATLGISRKVLWEKMRKY
FT                   QIADGETELRELE"
     atgaaaaccg atcgctgggc gtacgaaacg cttgagattt ttgtctggga aggccgtcac        60
     gacattgccg atcgtgtggc gcggttcatg gcgccgttcg gggcagaggt gatccgcgcg       120
     ggcggcatcg actttcagcc ggccgagcct cggctcaagc ccgcggtggc ggtgatcagc       180
     gcctcggtgg tggaaagcgg cggctttacg gtgctcgact ggcaggccgc gcaaggcatg       240
     ccggtaatct gggtggcctc ggacgcgcag catgattcga gccgcttccc gcccgaatac       300
     acgcacgtgc tcgggccgga ctttggcgcg actgaactgc gcgcgcagat cagcaaggtc       360
     ttgccgtcga tgtcgtcggc gcaggcccag gcgcaggatc agagcgacct cgtggcggcg       420
     tcgccggcca tgcacgggct gctggagcag gtcgatacct ttgccgattg cgacagcaac       480
     gtcatgcttt acggcgaaac cggcgccggc aaggaacgta ttgcgcgctt gctgcatgac       540
     aagaacagtg tctatggcaa gggcccgttc gtggcggtca actgtggcgc gattcccgac       600
     gggctgttcg aatcccaatt ttttggccat gccaagggcg cgttcacggg cgccatgtat       660
     gcgcaccgcg gctactttga acaagcgaac ggcggcacgc tgtttctcga cgagctgggc       720
     gatctgccgc tgtatcagca ggtgaagctg ttgcgcgtgc tggaagacag cgaatgcacg       780
     cggctgggct cgacggtgcc ggtcaagctg gatttccgcc tggtggccgc taccaacaag       840
     aatctgcgcg agatggtcgc cacgggcaaa ttccgcgccg atctgtactt ccgcctggcg       900
     gtgatcgagc tgcgcatccc gagcctggag cagcgcggcg cggatgacaa gatcgcgctg       960
     ctgctttcct tcctgcggca tttgctgggc gacaaaacgt ttgatgccat gccgccggtg      1020
     cccgaatggg tgcgggcatc ggtcgggcgg gcctactttg ccggcaatgt gcgcgaactg      1080
     cgcaacctgg ccgagcgcat cggcatcacc ctgcgccagt tcggccgctg ggacgaggcc      1140
     cgcatcctgc cgctgtttgc cggcctgcag cgcgatgcgt tcgagcgcga ggcgggaaat      1200
     ggtggcaatg gcgggtatgg cgatcgcggt gggggtggaa gtggtggcaa tggcggcgaa      1260
     gaagagcgcc gccgtatcct cgcggcgctg gacgccaaca actggcgccg ccaggacacc      1320
     gccgccacac tcggcatcag ccgtaaggtt ttgtgggaaa agatgcgcaa ataccagatc      1380
     gccgacggcg aaaccgagct tcgcgagctg gagtga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page